BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0806 (753 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 25 0.49 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 25 0.49 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 23 2.6 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 21 8.0 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 21 8.0 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 25.4 bits (53), Expect = 0.49 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +2 Query: 122 PQPPVRLVSPQTLMGPQRSHFGQGIANSHRKVFIPISGPGPNGQGG 259 P+ V+L +PQ L H + S RK P NG+GG Sbjct: 331 PEVCVKLANPQKLTTAAGKHLRKVGDPSKRKGTYAFRTPDENGEGG 376 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 25.4 bits (53), Expect = 0.49 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +1 Query: 367 NQVHRHPAPMPEIMKQYHPPNWKALPPAPDLKLSKVENGIVIS 495 N HP +P + PP+ A P LK K+ N V+S Sbjct: 53 NPAFFHPGLLPLAWQANSPPSPPAPSELPALKSRKLNNNNVVS 95 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +1 Query: 277 IKPHPPGMQRPRTAAPNIGRAQNQIKTNKPN 369 I+P G +PR A P + Q K P+ Sbjct: 100 IRPGVIGGSKPRVATPEVENRIEQYKRENPS 130 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 21.4 bits (43), Expect = 8.0 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 552 YAYQETSAPPSTALWKKIGDVKALPLPMACTLTHFTAGYSYY 677 Y++++ + S LWKKI V + + A T ++YY Sbjct: 30 YSFEKPDSQKS--LWKKIQGVVLVSIIAAGTAYSIYVRHTYY 69 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 21.4 bits (43), Expect = 8.0 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 552 YAYQETSAPPSTALWKKIGDVKALPLPMACTLTHFTAGYSYY 677 Y++++ + S LWKKI V + + A T ++YY Sbjct: 30 YSFEKPDSQKS--LWKKIQGVVLVSIIAAGTAYSIYVRHTYY 69 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,459 Number of Sequences: 336 Number of extensions: 4539 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -