BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0805 (769 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 2.4 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 2.4 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 5.5 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 21 9.5 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 23.4 bits (48), Expect = 2.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 384 ILFHPSIETDTVSSSGRSTYIFLLANIHLTDYKAILII 271 +LFH +T V +SGR I LLA + + L++ Sbjct: 536 LLFHHR-DTPVVRASGRELTIILLAGVLVCYLNTFLLL 572 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 23.4 bits (48), Expect = 2.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 384 ILFHPSIETDTVSSSGRSTYIFLLANIHLTDYKAILII 271 +LFH +T V +SGR I LLA + + L++ Sbjct: 626 LLFHHR-DTPVVRASGRELTIILLAGVLVCYLNTFLLL 662 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/44 (22%), Positives = 20/44 (45%) Frame = -2 Query: 384 ILFHPSIETDTVSSSGRSTYIFLLANIHLTDYKAILIIRVYKIC 253 ++ +P+ ++ + Y LL HL + +I+VY C Sbjct: 181 LVANPTANYSASTTLSHAEYSMLLVYFHLQRHMGNFLIQVYGPC 224 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 ILNRYYQSYIKITYYWKYI 158 I +R + +K+ Y WKYI Sbjct: 20 IHSRNLTNSLKVIYEWKYI 38 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,567 Number of Sequences: 438 Number of extensions: 3839 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -