BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0804 (724 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 6.7 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 21 8.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 8.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 8.9 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 649 LFFNRMDTMIY*LSQRTTG 705 L NR+DT+IY + +R G Sbjct: 549 LLRNRLDTLIYPIIRRKLG 567 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 21.4 bits (43), Expect = 8.9 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -3 Query: 656 KNKDLDKEILEFDQLQRC*SLLPKLSVPITVDDKTASNS 540 K K L + I D L++ P L PIT D+K N+ Sbjct: 1 KEKHLTQRINSCDLLKKRNENDPFLKRPITGDEKWVVNN 39 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 8.9 Identities = 5/10 (50%), Positives = 8/10 (80%) Frame = +3 Query: 135 WITYPFTWWS 164 ++TY + WWS Sbjct: 519 YLTYEYPWWS 528 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 8.9 Identities = 5/10 (50%), Positives = 8/10 (80%) Frame = +3 Query: 135 WITYPFTWWS 164 ++TY + WWS Sbjct: 572 YLTYEYPWWS 581 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,792 Number of Sequences: 438 Number of extensions: 4233 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -