BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0803 (761 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 27 0.16 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 6.1 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 21 8.1 AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 21 8.1 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 21 8.1 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 27.1 bits (57), Expect = 0.16 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -1 Query: 227 PSAANVTSTRSPRDSRP*KPADIFAWKLFQHSENCSSDAMIATTRRGT 84 P+ A+ T T S S PA I ++ L QH CSS + +T T Sbjct: 203 PTIASATYTNSANSSIW-SPASIDSFTLEQHRSWCSSSQPVLSTTNST 249 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 716 VFCRTRGTCFQWIYAFS 666 VFCR R + + YAFS Sbjct: 112 VFCRDRVNPYLFYYAFS 128 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = -2 Query: 643 EEELFDAIDGLFG 605 +E+L+DAI+ L+G Sbjct: 337 KEKLYDAIEALYG 349 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = +2 Query: 215 WLPKALLQAHKLVHQYVLPIFK 280 W P+ L+ L H +L + K Sbjct: 167 WYPRMLISTKLLAHFLILTVLK 188 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = +2 Query: 215 WLPKALLQAHKLVHQYVLPIFK 280 W P+ L+ L H +L + K Sbjct: 167 WYPRMLISTKLLAHFLILTVLK 188 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,389 Number of Sequences: 336 Number of extensions: 3379 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -