BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0802 (753 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 25 0.86 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 24 1.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 3.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 3.5 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 4.6 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 24.6 bits (51), Expect = 0.86 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -3 Query: 466 EYHSFSHSNDKLLVPKYVLS 407 ++H+ S ND ++ PK++LS Sbjct: 577 DFHNMSFENDFIIQPKHLLS 596 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 24.2 bits (50), Expect = 1.1 Identities = 15/65 (23%), Positives = 29/65 (44%) Frame = +2 Query: 62 RLPIPDLQKTGDRYLRALKPLLTNSLYDDAQQRTLKFVNGEGLEIQEKLISKDKMNKNTS 241 RL + D+ + DR A+ + D+ Q + EG+++ +I ++ N + Sbjct: 302 RLSLDDMDRWRDRIYDAIHSGVVRG--DNGQN--IPLTEFEGIDVLGNIIESSILSPNRN 357 Query: 242 YISDF 256 Y DF Sbjct: 358 YYGDF 362 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +3 Query: 525 LFKAFPL-DMSQFVGLFGATRLPQIG 599 L+K + + +S+F+ LFG P IG Sbjct: 145 LYKLWKMPSLSEFLSLFGTETCPAIG 170 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +3 Query: 525 LFKAFPL-DMSQFVGLFGATRLPQIG 599 L+K + + +S+F+ LFG P IG Sbjct: 145 LYKLWKMPSLSEFLSLFGTETCPAIG 170 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -2 Query: 152 VHHHIKSLLGVVSRPA 105 VHHH SLLG V A Sbjct: 134 VHHHQTSLLGKVEGAA 149 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,303 Number of Sequences: 336 Number of extensions: 3452 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -