BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0802 (753 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0290 + 15383473-15383669,15385057-15385267,15386389-153864... 28 6.9 >08_02_0290 + 15383473-15383669,15385057-15385267,15386389-15386440, 15386545-15386863,15387022-15387121,15387391-15387657, 15387780-15387857,15387943-15388032,15388119-15388168, 15388267-15388366,15388777-15388875,15389023-15389136, 15389238-15389412,15389726-15390132,15390565-15390639, 15391412-15391438 Length = 786 Score = 28.3 bits (60), Expect = 6.9 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = +1 Query: 427 PEVYHLNAKKSDTPLFRTVTGLLPEAIFGMVHIYSKHFH*I*VNLLDYLELHVYL 591 PE++ +NA L+ TV G L +H+ FH + ++D +L +L Sbjct: 407 PEMFVVNAGNGFKLLWNTVKGFLDPKTASKIHVLGTKFHGKLLEVIDASQLPEFL 461 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,264,227 Number of Sequences: 37544 Number of extensions: 324765 Number of successful extensions: 666 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2004270760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -