BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0802 (753 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19020.1 68417.m02803 chromomethylase 2 (CMT2) nearly identic... 31 1.1 At4g19860.1 68417.m02910 lecithin:cholesterol acyltransferase fa... 28 7.7 >At4g19020.1 68417.m02803 chromomethylase 2 (CMT2) nearly identical to chromomethylase CMT2 [Arabidopsis thaliana] GI:14583094 Length = 1295 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +2 Query: 23 SKVPTMHFQKSLPRLPIPDLQKTG-DRYLRALKPLLTNSLYDDAQQRTLKFVNGEGLEIQ 199 S +P + + +LP L KT RY+R+ K LT S D+ +RT+ + I Sbjct: 1061 SDLPHVSNDEDREKLPYESLPKTDFQRYIRSTKRDLTGSAIDNCNKRTMLLHDHRPFHIN 1120 Query: 200 E 202 E Sbjct: 1121 E 1121 >At4g19860.1 68417.m02910 lecithin:cholesterol acyltransferase family protein / LACT family protein similar to lysosomal phospholipase A2 [Mus musculus] GI:18699602; contains Pfam profile PF02450: Lecithin:cholesterol acyltransferase (phosphatidylcholine-sterol acyltransferase) Length = 535 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 588 PQIGKDKLFRDPKSKHVLVQRRGRFYAFDVLDKD 689 P GK + DPK+ V+ Q R +A DVLD D Sbjct: 79 PSTGKT-ISLDPKTSIVVPQDRAGLHAIDVLDPD 111 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,894,879 Number of Sequences: 28952 Number of extensions: 295891 Number of successful extensions: 672 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 672 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1672953192 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -