BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0801 (724 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC664.05 |rpl13||60S ribosomal protein L13|Schizosaccharomyces... 97 3e-21 SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pomb... 28 1.2 >SPAC664.05 |rpl13||60S ribosomal protein L13|Schizosaccharomyces pombe|chr 1|||Manual Length = 208 Score = 96.7 bits (230), Expect = 3e-21 Identities = 61/199 (30%), Positives = 90/199 (45%) Frame = +2 Query: 35 IPNGHFHKDWQRFVKTWFNQPARRYRRKQNRIXXXXXXXXXXXXXXLRPIVRCPTVRYHT 214 +PN HFHKDWQR+VKTWFNQP R+ RR+Q R +RP V+ PT+RY+ Sbjct: 9 LPNAHFHKDWQRYVKTWFNQPGRKLRRRQAR-QTKAAKIAPRPVEAIRPAVKPPTIRYNM 67 Query: 215 KVRAGRGFTLREIRAQDXTQYXPERFGXL*IXXDAKXLLKSXXNPCFXXXXVXSACFXVX 394 KVRAGRGFTL E++A ++ G + + + + V A V Sbjct: 68 KVRAGRGFTLEELKAAGVSRRVASTIG-IPVDHRRRNRSEESLQRNVERIKVYLAHLIVF 126 Query: 395 PKGKXXLKGGXXXXXXXLXTQLRGPLMPVQXPAPKSVADLSLKMKRTSKLINTLRGARSI 574 P+ K G ++P+ A + ++ + K + +TL R+ Sbjct: 127 PRKAGQPKKGDATDVSGAEQTDVAAVLPITQEAVEEAKPITEEAKNFN-AFSTLSNERAY 185 Query: 575 AKLVGIRAKRLXDAAENPD 631 A+ G RA AE + Sbjct: 186 ARYAGARAAFQKKRAEEAE 204 >SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1283 Score = 28.3 bits (60), Expect = 1.2 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = -1 Query: 247 TKSESSTGAYFSM----VPNSWASHYRT*RPSCRTWSYGLSFLY 128 T +STG+Y M + W S T C TWSY S+ Y Sbjct: 1215 TVQGTSTGSYICMPHFQIQYDWCSAGVTDMSECNTWSYQKSYDY 1258 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,258,585 Number of Sequences: 5004 Number of extensions: 35976 Number of successful extensions: 101 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 339215786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -