BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0800 (514 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5V205 Cluster: Ribonucleoside-triphosphate reductase; ... 36 0.41 UniRef50_Q8I2R1 Cluster: Putative uncharacterized protein PFI121... 33 2.9 UniRef50_UPI00015A4429 Cluster: UPI00015A4429 related cluster; n... 33 5.0 >UniRef50_A5V205 Cluster: Ribonucleoside-triphosphate reductase; n=3; Chloroflexi (class)|Rep: Ribonucleoside-triphosphate reductase - Roseiflexus sp. RS-1 Length = 768 Score = 36.3 bits (80), Expect = 0.41 Identities = 14/31 (45%), Positives = 23/31 (74%) Frame = -3 Query: 137 YSRHSRELGRRQTYLKTISKKIDSLVEILKD 45 YSR + ELGRR+T+++T+ + +D L E+ D Sbjct: 153 YSRFNYELGRRETWIETVDRAVDYLYELAGD 183 >UniRef50_Q8I2R1 Cluster: Putative uncharacterized protein PFI1210w; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein PFI1210w - Plasmodium falciparum (isolate 3D7) Length = 2082 Score = 33.5 bits (73), Expect = 2.9 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = -3 Query: 500 YLTKKILTR*FSISLNSICTVNILYKIMYQGSFNEQTYSILLQY 369 Y+ KI+ FS +++ + +N+L+KI+Y S N T I +Y Sbjct: 804 YMDNKIVEHTFSNNISYMEKINMLFKILYNHSLNISTCKIFFKY 847 >UniRef50_UPI00015A4429 Cluster: UPI00015A4429 related cluster; n=1; Danio rerio|Rep: UPI00015A4429 UniRef100 entry - Danio rerio Length = 1023 Score = 32.7 bits (71), Expect = 5.0 Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Frame = +1 Query: 322 NNRFCKIGHKSHP*SRYCNNML*VCSLKLPWYIILYNILTVQI-LFKLILNYLVSIFFVK 498 N + C +G+ S Y + CS+ L YI+L++IL I L+ +ILNY++ + V Sbjct: 249 NFKSCLLGYTSI----YAGLHILFCSINLS-YILLFSILLFSIILYYIILNYIILYYIVL 303 Query: 499 Y 501 Y Sbjct: 304 Y 304 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 445,352,938 Number of Sequences: 1657284 Number of extensions: 8034080 Number of successful extensions: 15798 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15794 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 31364627325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -