BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0800 (514 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0372 + 7864015-7864065,7864167-7864208,7864292-7864322,786... 29 1.7 >03_02_0372 + 7864015-7864065,7864167-7864208,7864292-7864322, 7864472-7864653 Length = 101 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -1 Query: 382 YYCNTSTRDEICVRFCKI--DYCLLPPPXXWXEIDYCLLPLXLALSFGSKKC 233 Y C+ + R E C+++C I CL P + C L S G+ KC Sbjct: 49 YRCSATKRQEPCLKYCNICCQKCLCVPSGTSGNKEECPCYNNLKSSQGNSKC 100 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,637,159 Number of Sequences: 37544 Number of extensions: 215076 Number of successful extensions: 350 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 350 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1106928780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -