BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= e96h0800
(514 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
03_02_0372 + 7864015-7864065,7864167-7864208,7864292-7864322,786... 29 1.7
>03_02_0372 +
7864015-7864065,7864167-7864208,7864292-7864322,
7864472-7864653
Length = 101
Score = 29.5 bits (63), Expect = 1.7
Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 2/52 (3%)
Frame = -1
Query: 382 YYCNTSTRDEICVRFCKI--DYCLLPPPXXWXEIDYCLLPLXLALSFGSKKC 233
Y C+ + R E C+++C I CL P + C L S G+ KC
Sbjct: 49 YRCSATKRQEPCLKYCNICCQKCLCVPSGTSGNKEECPCYNNLKSSQGNSKC 100
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,637,159
Number of Sequences: 37544
Number of extensions: 215076
Number of successful extensions: 350
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 348
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 350
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1106928780
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -