BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0800 (514 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 23 4.6 AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection... 23 8.0 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 8.0 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.4 bits (48), Expect = 4.6 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -2 Query: 393 DLQHIIAIPRLGMRFVSDFAKSIIAFS 313 D ++ + P + +F+SDF+ +I FS Sbjct: 744 DFKNALFFPAVVRQFISDFSVTIAIFS 770 >AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection responsive shortpeptide protein. Length = 81 Score = 22.6 bits (46), Expect = 8.0 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = -1 Query: 445 VLLIYCTKLCTKAVLMSRLTAYYCNTSTRDEICVRFCKIDY 323 V ++ LCT AV + + AY + I R+C Y Sbjct: 4 VCILLAVLLCTAAVADAMVFAYAPTCARCKSIGARYCGYGY 44 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 22.6 bits (46), Expect = 8.0 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 114 RKKTDVFKNYFEE 76 RK TD+FK F+E Sbjct: 452 RKHTDIFKKLFQE 464 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 484,400 Number of Sequences: 2352 Number of extensions: 8524 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46514490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -