Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e96h0800
         (514 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly pro...    21   5.7  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             21   5.7  

>DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly
           protein 9 protein.
          Length = 423

 Score = 21.4 bits (43), Expect = 5.7
 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%)
 Frame = +1

Query: 412 WYIILYNILTVQILFKLIL-NYLVSIFFVKYKF 507
           W++ILY  +  Q      L ++  +IF VKY++
Sbjct: 6   WWLILYFSIVCQAKAHYSLRDFKANIFQVKYQW 38


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.4 bits (43), Expect = 5.7
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -1

Query: 313 PPPXXWXEIDYC 278
           PPP  W  +D C
Sbjct: 416 PPPEDWKPLDKC 427


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 133,335
Number of Sequences: 438
Number of extensions: 2756
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14232156
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)