BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0798 (661 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 23 1.7 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 22 3.9 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 22 3.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.1 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 5.1 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 9.0 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 23.4 bits (48), Expect = 1.7 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 627 KRRQYIID*LILIFIWNIHDINRFFFIRIKITK 529 K R Y+I + +F W I ++ + F RI + K Sbjct: 92 KLRHYLIFIFVNVFFWVIILMSNYAFTRIILLK 124 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.2 bits (45), Expect = 3.9 Identities = 7/24 (29%), Positives = 18/24 (75%) Frame = +3 Query: 135 RPELMIGYS*F*REMLMEPLIVYY 206 RP+L++ ++ F + +++P+I +Y Sbjct: 111 RPKLLLKHNLFLLDNIVKPIIAFY 134 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 22.2 bits (45), Expect = 3.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 309 LIRIPKCLLSFLVPY 265 ++ IP C+ F+VPY Sbjct: 127 ILIIPTCVAMFIVPY 141 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +3 Query: 36 RTFTSRPRAELPLVPESSLSWPDEG 110 RT T+RP ++ +WP +G Sbjct: 1059 RTTTTRPTTTSTTTRPTTTNWPTQG 1083 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 5.1 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -1 Query: 85 LSGTSGNSARGRDVNVRVQIRSFRRA 8 L+ S S RDVNVR + + A Sbjct: 102 LAKNSVGSVHSRDVNVRAVVNQYYEA 127 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 564 NRFFFIRIKITKLLVYFTTKSE 499 NRF + +++TKL TK++ Sbjct: 550 NRFVTLNVQLTKLTKNCATKAQ 571 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,961 Number of Sequences: 336 Number of extensions: 2976 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -