BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0798 (661 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2C4.09 |||DUF1640 family protein|Schizosaccharomyces pombe|c... 26 4.2 SPAC17H9.08 |||mitochondrial coenzyme A transporter|Schizosaccha... 26 5.5 SPAC2G11.05c |||BRO1 domain protein|Schizosaccharomyces pombe|ch... 26 5.5 >SPAC2C4.09 |||DUF1640 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 216 Score = 26.2 bits (55), Expect = 4.2 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +1 Query: 478 QNVNKLIFRFSSEIHEEFSNFDPNKKKSINIMY 576 + + +LI S++HE+ S+F K++ +MY Sbjct: 61 ETLMRLISNVYSDMHEKISDFSVTKEQQDRVMY 93 >SPAC17H9.08 |||mitochondrial coenzyme A transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 326 Score = 25.8 bits (54), Expect = 5.5 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = +2 Query: 137 PRVDDWVQLVLKRNADGTAHCLLQH*FKIS*LTRLKLL--SNFKSYGTKNDSKH 292 P D W LV A GTA C+ + ++ L R+K+L +N SY S+H Sbjct: 9 PEKDSWEFLVKSGIAGGTAGCVAKS--VVAPLDRVKILYQTNHASYRGYAYSRH 60 >SPAC2G11.05c |||BRO1 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 701 Score = 25.8 bits (54), Expect = 5.5 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +2 Query: 239 LKLLSNFKSYGTKNDSKHF-GIRINL*MAHKS 331 LK LS FKS+ +ND K F +R L ++H S Sbjct: 23 LKRLSCFKSFTYENDLKTFKALRSQLCLSHPS 54 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,528,116 Number of Sequences: 5004 Number of extensions: 49467 Number of successful extensions: 110 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -