BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0797 (813 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT029645-1|ABL75704.1| 269|Drosophila melanogaster IP17216p pro... 92 7e-19 AE014296-329|AAF47545.1| 277|Drosophila melanogaster CG7977-PA ... 92 7e-19 DQ450529-1|ABE27283.1| 277|Drosophila melanogaster L23A ribosom... 91 1e-18 AF080130-1|AAD19340.1| 269|Drosophila melanogaster ribosomal pr... 86 6e-17 >BT029645-1|ABL75704.1| 269|Drosophila melanogaster IP17216p protein. Length = 269 Score = 92.3 bits (219), Expect = 7e-19 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = +2 Query: 542 QRKVVKGEHGKRVRKIRNSVHFRRPKTFEPPRHPKYPRKSLPKRNRMDAYNIIKFP 709 Q+K++KG G R RKIR +VHFRRP T + PR PKYPRKS+P RNRMDAYNIIK+P Sbjct: 138 QKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKYPRKSVPTRNRMDAYNIIKYP 193 Score = 32.3 bits (70), Expect = 0.81 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 721 KAAMKKIEDNNTLVLLFTQVQTSTIFKAAVK 813 +AAMKKIEDNNTLV L +AAV+ Sbjct: 197 EAAMKKIEDNNTLVFLTHLRANKNHVRAAVR 227 >AE014296-329|AAF47545.1| 277|Drosophila melanogaster CG7977-PA protein. Length = 277 Score = 92.3 bits (219), Expect = 7e-19 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = +2 Query: 542 QRKVVKGEHGKRVRKIRNSVHFRRPKTFEPPRHPKYPRKSLPKRNRMDAYNIIKFP 709 Q+K++KG G R RKIR +VHFRRP T + PR PKYPRKS+P RNRMDAYNIIK+P Sbjct: 146 QKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKYPRKSVPTRNRMDAYNIIKYP 201 Score = 32.3 bits (70), Expect = 0.81 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 721 KAAMKKIEDNNTLVLLFTQVQTSTIFKAAVK 813 +AAMKKIEDNNTLV L +AAV+ Sbjct: 205 EAAMKKIEDNNTLVFLTHLRANKNHVRAAVR 235 >DQ450529-1|ABE27283.1| 277|Drosophila melanogaster L23A ribosomal protein naturalvariant protein. Length = 277 Score = 91.5 bits (217), Expect = 1e-18 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = +2 Query: 542 QRKVVKGEHGKRVRKIRNSVHFRRPKTFEPPRHPKYPRKSLPKRNRMDAYNIIKFP 709 Q+K++KG G R RKIR +VHFRRP T + PR PKYPRKS+P RNRMDAYNIIK+P Sbjct: 146 QKKIIKGAFGTRARKIRANVHFRRPTTLKLPRSPKYPRKSVPTRNRMDAYNIIKYP 201 Score = 32.7 bits (71), Expect = 0.61 Identities = 17/31 (54%), Positives = 21/31 (67%) Frame = +1 Query: 721 KAAMKKIEDNNTLVLLFTQVQTSTIFKAAVK 813 +AAMKKIEDNNTLV L + +AAV+ Sbjct: 205 EAAMKKIEDNNTLVFLTHLRANKSHVRAAVR 235 >AF080130-1|AAD19340.1| 269|Drosophila melanogaster ribosomal protein L23a protein. Length = 269 Score = 85.8 bits (203), Expect = 6e-17 Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = +2 Query: 542 QRKVVKGEHGKRVRKIRNSVHFRRPKTFEPPRHPKYPRKSLPKRNRMDAYNIIKFP 709 Q+K++K G R RKIR +VHFRRP T + PR PKYPRKS+P RNRMDAYNIIK+P Sbjct: 139 QKKIIKA-FGTRARKIRTNVHFRRPTTLKLPRSPKYPRKSVPTRNRMDAYNIIKYP 193 Score = 32.3 bits (70), Expect = 0.81 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 721 KAAMKKIEDNNTLVLLFTQVQTSTIFKAAVK 813 +AAMKKIEDNNTLV L +AAV+ Sbjct: 197 EAAMKKIEDNNTLVFLTHLRANKNHVRAAVR 227 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,313,784 Number of Sequences: 53049 Number of extensions: 360984 Number of successful extensions: 1206 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1203 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3818998872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -