BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0797 (813 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g55280.1 68416.m06139 60S ribosomal protein L23A (RPL23aB) va... 56 2e-08 At2g39460.1 68415.m04843 60S ribosomal protein L23A (RPL23aA) id... 53 2e-07 >At3g55280.1 68416.m06139 60S ribosomal protein L23A (RPL23aB) various ribosomal L23a proteins Length = 154 Score = 56.4 bits (130), Expect = 2e-08 Identities = 24/46 (52%), Positives = 30/46 (65%) Frame = +2 Query: 572 KRVRKIRNSVHFRRPKTFEPPRHPKYPRKSLPKRNRMDAYNIIKFP 709 K +KIR V F RPKT PR PKYP+ S RN++D Y I+K+P Sbjct: 33 KPAKKIRTKVTFHRPKTLTVPRKPKYPKISATPRNKLDHYQILKYP 78 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +1 Query: 721 KAAMKKIEDNNTLVLLFTQVQTSTIFKAAVK 813 ++AMKKIEDNNTLV + K AVK Sbjct: 82 ESAMKKIEDNNTLVFIVDIRADKKKIKDAVK 112 >At2g39460.1 68415.m04843 60S ribosomal protein L23A (RPL23aA) identical to GB:AF034694 Length = 154 Score = 53.2 bits (122), Expect = 2e-07 Identities = 23/46 (50%), Positives = 30/46 (65%) Frame = +2 Query: 572 KRVRKIRNSVHFRRPKTFEPPRHPKYPRKSLPKRNRMDAYNIIKFP 709 K+ +KIR V F RPKT PR KYP+ S RN++D Y I+K+P Sbjct: 33 KKDKKIRTKVTFHRPKTLTKPRTGKYPKISATPRNKLDHYQILKYP 78 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +1 Query: 721 KAAMKKIEDNNTLVLLFTQVQTSTIFKAAVK 813 ++AMKKIEDNNTLV + K AVK Sbjct: 82 ESAMKKIEDNNTLVFIVDIRADKKKIKDAVK 112 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,467,462 Number of Sequences: 28952 Number of extensions: 180997 Number of successful extensions: 517 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1853336000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -