BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0796 (983 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 136 3e-32 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 7e-10 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 6e-09 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 58 1e-08 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 58 1e-08 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 48 1e-05 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) 44 3e-04 SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 42 6e-04 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 40 0.003 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_37968| Best HMM Match : DEAD (HMM E-Value=3.6) 39 0.005 SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17) 39 0.005 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 38 0.009 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.012 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_26286| Best HMM Match : DUF963 (HMM E-Value=0.82) 38 0.012 SB_7956| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 38 0.017 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 38 0.017 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 38 0.017 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 38 0.017 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_28095| Best HMM Match : bZIP_1 (HMM E-Value=0.59) 37 0.022 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 37 0.029 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_41195| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 37 0.029 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_20200| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_11350| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_2526| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_13275| Best HMM Match : Phycoerythr_ab (HMM E-Value=0.23) 36 0.038 SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 36 0.050 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_18236| Best HMM Match : Histone (HMM E-Value=1.2) 36 0.050 SB_18140| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 36 0.050 SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 36 0.067 SB_37859| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 36 0.067 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 36 0.067 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 36 0.067 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 36 0.067 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 36 0.067 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 36 0.067 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 36 0.067 SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 36 0.067 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 36 0.067 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 36 0.067 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 36 0.067 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 36 0.067 SB_39773| Best HMM Match : DUF765 (HMM E-Value=4.1) 36 0.067 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.067 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 36 0.067 SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) 36 0.067 SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 36 0.067 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_29878| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_28438| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_27866| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_26033| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_18638| Best HMM Match : DUF765 (HMM E-Value=4) 36 0.067 SB_18123| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 36 0.067 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.067 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_12393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) 36 0.067 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) 36 0.067 SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_30200| Best HMM Match : P_proprotein (HMM E-Value=0.011) 35 0.088 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 35 0.088 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_17566| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 35 0.12 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 35 0.12 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 35 0.12 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_56273| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 35 0.12 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 35 0.12 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 35 0.12 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 35 0.12 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 35 0.12 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 35 0.12 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 35 0.12 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 35 0.12 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 35 0.12 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 35 0.12 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 35 0.12 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 35 0.12 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 35 0.12 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_37362| Best HMM Match : zf-RNPHF (HMM E-Value=3) 35 0.12 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 35 0.12 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) 35 0.12 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 35 0.12 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 35 0.12 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 35 0.12 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 35 0.12 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_14180| Best HMM Match : ERp29_N (HMM E-Value=3.4) 35 0.12 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 35 0.12 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 35 0.12 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 35 0.12 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) 35 0.12 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 35 0.12 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 35 0.12 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 35 0.12 SB_4480| Best HMM Match : TAT_ubiq (HMM E-Value=8.2) 35 0.12 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 35 0.12 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 35 0.12 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 35 0.12 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 35 0.12 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 35 0.12 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 35 0.12 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 35 0.12 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 35 0.12 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 35 0.12 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_42545| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_42492| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_42077| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 136 bits (329), Expect = 3e-32 Identities = 64/84 (76%), Positives = 69/84 (82%) Frame = +1 Query: 256 LADPPQNMIAQSQSGTGKTAAFVLAMLSRVDSNKNYPQVLCLSPTYELAIQTGEVAAKMA 435 LADPP NMIAQSQSGTGKTAAFVL MLSRVD+ K YPQV+CLSPTYELA QTG+VA M Sbjct: 138 LADPPVNMIAQSQSGTGKTAAFVLTMLSRVDATKPYPQVICLSPTYELARQTGKVAEAMG 197 Query: 436 KFCPEIKLKYAVRGEELPRGSKIT 507 K CP IK+ YAVRG + PRG K T Sbjct: 198 KHCPHIKINYAVRGNQFPRGQKCT 221 Score = 114 bits (274), Expect = 1e-25 Identities = 58/124 (46%), Positives = 73/124 (58%) Frame = +3 Query: 489 QGFKNHSHILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMINRQGHQDQCIRIHKCL 668 +G K HI+IGTPG + DW K F+ K+ VFVLDEAD+MI QGHQDQ IRIHK L Sbjct: 216 RGQKCTDHIIIGTPGTLLDWIRKSKCFEPRKVSVFVLDEADIMIALQGHQDQSIRIHKSL 275 Query: 669 PSTCQMMFFSATYGTAVMQFAEIIVSNPL*SAFERRRITGIT*NHIM*SAKVQKTNFRAI 848 CQ++ FSATY VM+FAE +V NP+ R + K + F A+ Sbjct: 276 HKDCQVLLFSATYDEDVMKFAETVVPNPIIIRLRREEESLDNIKQYYVVCKNSEDKFEAL 335 Query: 849 CNIY 860 CN+Y Sbjct: 336 CNMY 339 Score = 85.4 bits (202), Expect = 6e-17 Identities = 40/64 (62%), Positives = 49/64 (76%) Frame = +2 Query: 59 LLMKIIRQGLVESKLDIEIQRKDPNSPLYSVKTFEALHLKPNLLKGVYAMGFNAPSKIQE 238 LL K++R LV +K ++E+ R DP+SPLYS K+FE L L NL +GVY MGFN PSKIQE Sbjct: 72 LLTKLLRDKLVVTKHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQE 131 Query: 239 TALP 250 TALP Sbjct: 132 TALP 135 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 62.1 bits (144), Expect = 7e-10 Identities = 32/92 (34%), Positives = 56/92 (60%) Frame = +3 Query: 510 HILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMINRQGHQDQCIRIHKCLPSTCQMM 689 H+++GTPG++FD + G+ + IK+FVLDEAD M++R G +DQ + LP++ Q++ Sbjct: 211 HVVVGTPGRVFDM-INRGVLNTRDIKLFVLDEADEMLSR-GFKDQIYDVFTRLPTSVQVV 268 Query: 690 FFSATYGTAVMQFAEIIVSNPL*SAFERRRIT 785 SAT T V++ + + + +R +T Sbjct: 269 LLSATMPTDVLEVTNKFMRDVVRILVKREEVT 300 Score = 47.2 bits (107), Expect = 2e-05 Identities = 30/77 (38%), Positives = 43/77 (55%), Gaps = 6/77 (7%) Frame = +1 Query: 229 NSRNSTSYTLADPPQNMIAQSQSGTGKTAAFVLAMLSRVDSN---KN---YPQVLCLSPT 390 N N T +++IAQ+QSGTGKTA F +++L +D+N KN Q L L+PT Sbjct: 109 NQLNLTKNHYVLSARDVIAQAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPT 168 Query: 391 YELAIQTGEVAAKMAKF 441 ELA Q +V + + Sbjct: 169 RELAQQIQKVVLALGDY 185 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/33 (48%), Positives = 25/33 (75%) Frame = +2 Query: 149 VKTFEALHLKPNLLKGVYAMGFNAPSKIQETAL 247 V++F+ ++LK LL+G+YA GF PS IQ+ A+ Sbjct: 62 VESFDDMNLKEALLRGIYAYGFEKPSAIQQRAI 94 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 58.8 bits (136), Expect = 6e-09 Identities = 32/117 (27%), Positives = 63/117 (53%) Frame = +3 Query: 510 HILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMINRQGHQDQCIRIHKCLPSTCQMM 689 HI+ GTPG++FD ++ IK+ VLDEAD M+N+ G ++Q +++ LP Q++ Sbjct: 117 HIVSGTPGRVFDM-IRRRNLRTRSIKMLVLDEADEMLNK-GFKEQIYDVYRYLPPATQVV 174 Query: 690 FFSATYGTAVMQFAEIIVSNPL*SAFERRRITGIT*NHIM*SAKVQKTNFRAICNIY 860 SAT +++ +++P+ +R +T + + ++ F +C++Y Sbjct: 175 LLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLY 231 Score = 54.8 bits (126), Expect = 1e-07 Identities = 26/57 (45%), Positives = 38/57 (66%) Frame = +1 Query: 271 QNMIAQSQSGTGKTAAFVLAMLSRVDSNKNYPQVLCLSPTYELAIQTGEVAAKMAKF 441 +++IAQ+QSGTGKTA F +++L +D+ PQ L LSPT ELA Q +V + + Sbjct: 35 RDVIAQAQSGTGKTATFSISVLQAIDTQLREPQALVLSPTRELANQIQKVVLALGDY 91 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 57.6 bits (133), Expect = 1e-08 Identities = 24/56 (42%), Positives = 42/56 (75%) Frame = +1 Query: 271 QNMIAQSQSGTGKTAAFVLAMLSRVDSNKNYPQVLCLSPTYELAIQTGEVAAKMAK 438 ++++A++++GTGKTAA+++ +L R D+ KN Q L L PT ELA+QT ++ ++ K Sbjct: 85 RDILARAKNGTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGK 140 Score = 50.4 bits (115), Expect = 2e-06 Identities = 27/81 (33%), Positives = 47/81 (58%) Frame = +3 Query: 510 HILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMINRQGHQDQCIRIHKCLPSTCQMM 689 H+++ TPG++ D +K + DM K ++ V+DEAD +++ + +I K LP Q++ Sbjct: 174 HVIVATPGRVLDL-MKKKLADMSKCQMLVMDEADKLLS-MDFKKMLEQIIKHLPENRQIL 231 Query: 690 FFSATYGTAVMQFAEIIVSNP 752 FSAT+ +V F E + P Sbjct: 232 LFSATFPISVRDFKEKHLRKP 252 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +2 Query: 158 FEALHLKPNLLKGVYAMGFNAPSKIQETALP 250 FE LK LL G++ GF+ PS IQE ++P Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIP 79 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 57.6 bits (133), Expect = 1e-08 Identities = 24/56 (42%), Positives = 42/56 (75%) Frame = +1 Query: 271 QNMIAQSQSGTGKTAAFVLAMLSRVDSNKNYPQVLCLSPTYELAIQTGEVAAKMAK 438 ++++A++++GTGKTAA+++ +L R D+ KN Q L L PT ELA+QT ++ ++ K Sbjct: 85 RDILARAKNGTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGK 140 Score = 50.4 bits (115), Expect = 2e-06 Identities = 27/81 (33%), Positives = 47/81 (58%) Frame = +3 Query: 510 HILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMINRQGHQDQCIRIHKCLPSTCQMM 689 H+++ TPG++ D +K + DM K ++ V+DEAD +++ + +I K LP Q++ Sbjct: 174 HVIVATPGRVLDL-MKKKLADMSKCQMLVMDEADKLLS-MDFKKMLEQIIKHLPENRQIL 231 Query: 690 FFSATYGTAVMQFAEIIVSNP 752 FSAT+ +V F E + P Sbjct: 232 LFSATFPISVRDFKEKHLRKP 252 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +2 Query: 158 FEALHLKPNLLKGVYAMGFNAPSKIQETALP 250 FE LK LL G++ GF+ PS IQE ++P Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIP 79 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 48.0 bits (109), Expect = 1e-05 Identities = 25/76 (32%), Positives = 40/76 (52%) Frame = +1 Query: 274 NMIAQSQSGTGKTAAFVLAMLSRVDSNKNYPQVLCLSPTYELAIQTGEVAAKMAKFCPEI 453 ++IAQ++SGTGKT F + L V + N Q++ L+PT E+A+Q +V + + Sbjct: 52 DLIAQAKSGTGKTCVFSVIALENVITESNCIQIIILTPTREIAVQVKDVICAIGCHYDGL 111 Query: 454 KLKYAVRGEELPRGSK 501 K + G L K Sbjct: 112 ACKVFIGGISLEEDKK 127 Score = 47.6 bits (108), Expect = 2e-05 Identities = 26/81 (32%), Positives = 44/81 (54%) Frame = +3 Query: 510 HILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMINRQGHQDQCIRIHKCLPSTCQMM 689 HI +GTPG++ + ++ +++F+LDEAD +++ + Q Q I LP QMM Sbjct: 133 HIAVGTPGRV-KYLIEQKYLKTESVRMFILDEADKLLD-ESFQQQINWIFSALPENKQMM 190 Query: 690 FFSATYGTAVMQFAEIIVSNP 752 FSATY + + ++ P Sbjct: 191 AFSATYPEVLANHLKKYMTEP 211 Score = 32.7 bits (71), Expect = 0.47 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +2 Query: 158 FEALHLKPNLLKGVYAMGFNAPSKIQETALP 250 F +L L P LL+G+ GF PS IQ A+P Sbjct: 15 FHSLLLSPTLLRGLNEAGFEKPSPIQLKAIP 45 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/59 (35%), Positives = 41/59 (69%), Gaps = 2/59 (3%) Frame = +1 Query: 271 QNMIAQSQSGTGKTAAFVLAMLSRVDSN--KNYPQVLCLSPTYELAIQTGEVAAKMAKF 441 ++++A +++G+GKTAAF++ M ++ ++ K + L LSPT ELA+QT + ++ +F Sbjct: 319 KDVVAMARTGSGKTAAFLIPMFEKLQTHTAKVGIRALILSPTRELALQTQKFIKELGRF 377 >SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) Length = 475 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/62 (37%), Positives = 35/62 (56%) Frame = +1 Query: 274 NMIAQSQSGTGKTAAFVLAMLSRVDSNKNYPQVLCLSPTYELAIQTGEVAAKMAKFCPEI 453 ++I Q++SG GKTA FVLA L +++ VL + T ELA Q + + K+ I Sbjct: 86 DIICQAKSGMGKTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQIHKEYERFCKYMSNI 145 Query: 454 KL 459 K+ Sbjct: 146 KI 147 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +2 Query: 119 RKDPNSPLYSVKT--FEALHLKPNLLKGVYAMGFNAPSKIQETALP 250 +KD S+ + F LKP LL+ + GF PS++Q +P Sbjct: 34 KKDVKGTYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIP 79 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +3 Query: 501 NHSHILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMINR 626 N HI++GTPG++ + ++ K F+LDE D M+ + Sbjct: 166 NCPHIVVGTPGRILAL-TREKTLNLKHAKHFILDECDKMLEQ 206 >SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/62 (37%), Positives = 35/62 (56%) Frame = +1 Query: 274 NMIAQSQSGTGKTAAFVLAMLSRVDSNKNYPQVLCLSPTYELAIQTGEVAAKMAKFCPEI 453 ++I Q++SG GKTA FVLA L +++ VL + T ELA Q + + K+ I Sbjct: 86 DIICQAKSGMGKTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQIHKEYERFCKYMSNI 145 Query: 454 KL 459 K+ Sbjct: 146 KI 147 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +2 Query: 119 RKDPNSPLYSVKT--FEALHLKPNLLKGVYAMGFNAPSKIQETALP 250 +KD S+ + F LKP LL+ + GF PS++Q +P Sbjct: 34 KKDVKGTYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIP 79 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +3 Query: 501 NHSHILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMINR 626 N HI++GTPG++ + ++ K F+LDE D M+ + Sbjct: 166 NCPHIVVGTPGRILAL-TREKTLNLKHAKHFILDECDKMLEQ 206 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 42.3 bits (95), Expect = 6e-04 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 4/84 (4%) Frame = +3 Query: 510 HILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMINRQGHQDQCIRI--HKCLPST-- 677 H+L+ TPG++ D + G + I+ VLDEAD M++ G + Q RI +P T Sbjct: 977 HLLVATPGRLVDM-MDRGRVGLDSIRFLVLDEADRMLD-MGFEPQIRRIVDQDSMPKTGI 1034 Query: 678 CQMMFFSATYGTAVMQFAEIIVSN 749 Q + FSAT+ + A + N Sbjct: 1035 RQTLMFSATFPKEIQMLARDFLEN 1058 Score = 31.9 bits (69), Expect = 0.82 Identities = 12/25 (48%), Positives = 23/25 (92%) Frame = +1 Query: 271 QNMIAQSQSGTGKTAAFVLAMLSRV 345 ++++A +Q+G+GKTAAF++ +LSR+ Sbjct: 913 RDLMACAQTGSGKTAAFLIPILSRI 937 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 42.3 bits (95), Expect = 6e-04 Identities = 25/84 (29%), Positives = 42/84 (50%) Frame = +3 Query: 501 NHSHILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMINRQGHQDQCIRIHKCLPSTC 680 N H++I TPG++ D ++ KI+ VLDEAD +++ D + I +P Sbjct: 124 NKPHVVIATPGRLADHIKSTDTLNLKKIQFLVLDEADRLLDPSFGDDLKV-IFDAVPEKR 182 Query: 681 QMMFFSATYGTAVMQFAEIIVSNP 752 Q + FSAT + + ++ S P Sbjct: 183 QTLLFSATLTDTMGELQKMSGSQP 206 Score = 33.5 bits (73), Expect = 0.27 Identities = 17/49 (34%), Positives = 30/49 (61%) Frame = +1 Query: 271 QNMIAQSQSGTGKTAAFVLAMLSRVDSNKNYPQVLCLSPTYELAIQTGE 417 ++ I +++G+GKTAAF L +L ++ + + L+PT ELA Q + Sbjct: 45 RDCIGCAKTGSGKTAAFALPILQKLCDDPYGIFAVVLTPTRELAFQIAD 93 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 6/54 (11%) Frame = +1 Query: 271 QNMIAQSQSGTGKTAAFVLAMLSRVDSNK------NYPQVLCLSPTYELAIQTG 414 +++I Q+++GTGKT +F L ++ ++ K P+VL ++PT ELA Q G Sbjct: 111 EDVIGQARTGTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQVG 164 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/37 (43%), Positives = 27/37 (72%) Frame = +3 Query: 513 ILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMIN 623 +L+GTPG++ D+ ++ G D+ K+K VLDE D M++ Sbjct: 198 VLVGTPGRILDF-MRQGTLDLSKLKHVVLDEVDRMLD 233 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 5/78 (6%) Frame = +1 Query: 271 QNMIAQSQSGTGKTAAFVLAMLSR-----VDSNKNYPQVLCLSPTYELAIQTGEVAAKMA 435 ++++A +Q+G+GKTAA++L +L+ +++ P LC++PT ELA Q A K + Sbjct: 517 RDLMACAQTGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFS 576 Query: 436 KFCPEIKLKYAVRGEELP 489 P IK+ G +P Sbjct: 577 DHTP-IKVCVCYGGVSVP 593 Score = 35.1 bits (77), Expect = 0.088 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 7/81 (8%) Frame = +3 Query: 510 HILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMINRQGHQDQCIRIHKCL------- 668 H L+GTPG++ D+ + ++ +G I+ +LDEAD M++ D IHK + Sbjct: 604 HFLVGTPGRLQDFVSREKIY-LGSIQHLILDEADRMLDLGFGPD----IHKLIEESNMTA 658 Query: 669 PSTCQMMFFSATYGTAVMQFA 731 + Q + FSAT+ + A Sbjct: 659 KESRQTLMFSATFPDEIQHLA 679 >SB_37968| Best HMM Match : DEAD (HMM E-Value=3.6) Length = 127 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/65 (35%), Positives = 35/65 (53%) Frame = +3 Query: 582 IKVFVLDEADVMINRQGHQDQCIRIHKCLPSTCQMMFFSATYGTAVMQFAEIIVSNPL*S 761 +++ VLDEAD M++ G R+ LP+ Q + FSAT+ + AE ++ NPL Sbjct: 4 VEILVLDEADRMLD-MGFIHDIRRVLTKLPAKRQNLLFSATFSDDIKALAEKLLHNPLEI 62 Query: 762 AFERR 776 RR Sbjct: 63 EVARR 67 >SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17) Length = 635 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/53 (35%), Positives = 34/53 (64%) Frame = +3 Query: 513 ILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMINRQGHQDQCIRIHKCLP 671 I+ GTPGK+ D+ + + ++K F+LDEAD ++ QG+ D ++I+ +P Sbjct: 138 IVTGTPGKLNDF-ITTDKISLHQVKFFILDEADGLL-AQGNNDLIMKIYNKIP 188 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 38.7 bits (86), Expect = 0.007 Identities = 24/76 (31%), Positives = 41/76 (53%) Frame = +3 Query: 510 HILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMINRQGHQDQCIRIHKCLPSTCQMM 689 ++LI TPG++ D F ++ V+DEAD ++ G +++ +I + LPS Q + Sbjct: 696 NLLIATPGRLLDHLQNTQGFLYKNLQCLVIDEADRILEI-GFEEEMRQIIRILPSKRQTV 754 Query: 690 FFSATYGTAVMQFAEI 737 FSAT V A++ Sbjct: 755 LFSATQTKNVEDLAKL 770 Score = 35.1 bits (77), Expect = 0.088 Identities = 20/60 (33%), Positives = 38/60 (63%), Gaps = 4/60 (6%) Frame = +1 Query: 271 QNMIAQSQSGTGKTAAF---VLAMLSRVD-SNKNYPQVLCLSPTYELAIQTGEVAAKMAK 438 ++++ +++G+GKT AF V+ +L ++ +N V+ +SPT EL++QT VA + K Sbjct: 610 RDLLGAAKTGSGKTLAFLVPVVELLYKLQFKTRNGTGVIIISPTRELSLQTYGVARDLLK 669 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 38.3 bits (85), Expect = 0.009 Identities = 22/52 (42%), Positives = 34/52 (65%) Frame = +2 Query: 20 AAALELVDPPGCRLLMKIIRQGLVESKLDIEIQRKDPNSPLYSVKTFEALHL 175 AAALELVDPPGCR + +++ G++ S L+ +Q++ + Y + FE L L Sbjct: 10 AAALELVDPPGCRNSISLVQCGMLYS-LEPGLQKRFEHHGAYEM--FEELKL 58 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/77 (29%), Positives = 41/77 (53%) Frame = +3 Query: 507 SHILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMINRQGHQDQCIRIHKCLPSTCQM 686 ++I++ TPG++ + FD +++ VLDEAD +++ G I + LPS Q Sbjct: 172 TNIVVCTPGRLLQHMDETPNFDCTSLQILVLDEADRILD-MGFAPTLNAIIENLPSERQT 230 Query: 687 MFFSATYGTAVMQFAEI 737 + +SAT +V A + Sbjct: 231 LLYSATQTRSVKDLARL 247 Score = 33.1 bits (72), Expect = 0.36 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 4/58 (6%) Frame = +1 Query: 271 QNMIAQSQSGTGKTAAFVLAMLSRVDSNKNYPQ----VLCLSPTYELAIQTGEVAAKM 432 ++++ +++G+GKT AF++ ++ + K L +SPT ELA QT EV K+ Sbjct: 88 RDVLGAAKTGSGKTLAFLIPIIETLWRQKWTSMDGLGALVISPTRELAYQTFEVLVKI 145 >SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = -1 Query: 107 YLV*IQLDLAV*FSLKACSPGDPLVLERPP 18 YL+ I++ A +CSPGDPLVLERPP Sbjct: 9 YLIVIEIVEAAGVGSNSCSPGDPLVLERPP 38 >SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 FS +CSPGDPLVLERPP Sbjct: 5 FSSNSCSPGDPLVLERPP 22 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +1 Query: 4 SSTAVGGRSRTSGSPGLQAFN 66 SST+ GGRSRTSGSPGLQ F+ Sbjct: 99 SSTSGGGRSRTSGSPGLQEFD 119 >SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 FS +CSPGDPLVLERPP Sbjct: 26 FSSNSCSPGDPLVLERPP 43 >SB_26286| Best HMM Match : DUF963 (HMM E-Value=0.82) Length = 167 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = +1 Query: 19 GGRSRTSGSPGLQAFNENHTARSS 90 GGRSRTSGSPGLQ F++ H S Sbjct: 9 GGRSRTSGSPGLQEFDQKHITEYS 32 >SB_7956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = -1 Query: 86 DLAV*FSLKACSPGDPLVLERPP 18 ++ V F+ +CSPGDPLVLERPP Sbjct: 2 EIKVGFTSNSCSPGDPLVLERPP 24 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = -1 Query: 110 LYLV*IQLDLAV*FSLKACSPGDPLVLERPP 18 LYLV +D F +CSPGDPLVLERPP Sbjct: 5 LYLV--SVDKIADFVSNSCSPGDPLVLERPP 33 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 37.5 bits (83), Expect = 0.017 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = +2 Query: 20 AAALELVDPPGCRLLMKIIRQGLVES 97 AAALELVDPPGCR ++ + Q LVE+ Sbjct: 10 AAALELVDPPGCRNSIRTVAQLLVEA 35 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 37.5 bits (83), Expect = 0.017 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -1 Query: 80 AV*FSLKACSPGDPLVLERPP 18 AV F +CSPGDPLVLERPP Sbjct: 152 AVAFPSNSCSPGDPLVLERPP 172 >SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.5 bits (83), Expect = 0.017 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -1 Query: 83 LAV*FSLKACSPGDPLVLERPP 18 +A+ F +CSPGDPLVLERPP Sbjct: 1 MAILFLSNSCSPGDPLVLERPP 22 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 37.5 bits (83), Expect = 0.017 Identities = 19/49 (38%), Positives = 29/49 (59%) Frame = +1 Query: 271 QNMIAQSQSGTGKTAAFVLAMLSRVDSNKNYPQVLCLSPTYELAIQTGE 417 +++I +++G+GKT AF L +L + N L L+PT ELA Q E Sbjct: 2 KDVIGLAETGSGKTGAFALPILQALLDNPQRLFALILTPTRELAFQISE 50 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +3 Query: 510 HILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMINRQGHQDQCI 650 HI+I TPG++ D F + +K V+DEAD ++N ++ I Sbjct: 84 HIIIATPGRLIDHLENTKGFSLRTLKYLVMDEADRILNMDFEKEDYI 130 >SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 137 Score = 37.5 bits (83), Expect = 0.017 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -1 Query: 89 LDLAV*FSLKACSPGDPLVLERPP 18 +D V ++ +CSPGDPLVLERPP Sbjct: 6 IDTNVSYTSNSCSPGDPLVLERPP 29 >SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.5 bits (83), Expect = 0.017 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -1 Query: 92 QLDLAV*FSLKACSPGDPLVLERPP 18 +LDL F+ +CSPGDPLVLERPP Sbjct: 15 RLDLT--FTSNSCSPGDPLVLERPP 37 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -1 Query: 80 AV*FSLKACSPGDPLVLERPP 18 AV F +CSPGDPLVLERPP Sbjct: 6 AVLFVSNSCSPGDPLVLERPP 26 >SB_28095| Best HMM Match : bZIP_1 (HMM E-Value=0.59) Length = 160 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 19 GGRSRTSGSPGLQAFNENHTAR 84 GGRSRTSGSPGLQ F+ AR Sbjct: 9 GGRSRTSGSPGLQEFDNKRAAR 30 >SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.1 bits (82), Expect = 0.022 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -1 Query: 83 LAV*FSLKACSPGDPLVLERPP 18 + V F+ +CSPGDPLVLERPP Sbjct: 3 MRVIFTSNSCSPGDPLVLERPP 24 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 37.1 bits (82), Expect = 0.022 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 9/64 (14%) Frame = +1 Query: 271 QNMIAQSQSGTGKTAAFVLAML---------SRVDSNKNYPQVLCLSPTYELAIQTGEVA 423 ++++A +Q+G+GKTAAF+L ++ S S PQ +C++PT ELA Q A Sbjct: 749 RDVMACAQTGSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQIYLEA 808 Query: 424 AKMA 435 K A Sbjct: 809 RKFA 812 Score = 37.1 bits (82), Expect = 0.022 Identities = 23/78 (29%), Positives = 44/78 (56%), Gaps = 4/78 (5%) Frame = +3 Query: 510 HILIGTPGKMFDWGVKFGMFDMGKIKVFVLDEADVMINRQGHQDQCIRIHKCL----PST 677 ++L+GTPG++ D+ ++ G + ++ +LDEAD M++ G + RI + + S Sbjct: 840 NLLVGTPGRLTDF-IEKGKVSLKGLQFLILDEADRMLD-MGFEPAIRRIVESMGMPDKSE 897 Query: 678 CQMMFFSATYGTAVMQFA 731 Q + FSAT+ + + A Sbjct: 898 RQTLMFSATFPEEIQRLA 915 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 36.7 bits (81), Expect = 0.029 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F+ +CSPGDPLVLERPP Sbjct: 80 FTSNSCSPGDPLVLERPP 97 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.7 bits (81), Expect = 0.029 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F+ +CSPGDPLVLERPP Sbjct: 15 FTSNSCSPGDPLVLERPP 32 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/49 (42%), Positives = 33/49 (67%), Gaps = 3/49 (6%) Frame = +1 Query: 271 QNMIAQSQSGTGKTAAFVLAMLSRV---DSNKNYPQVLCLSPTYELAIQ 408 +++ A + +GTGKTAAF+L +L R+ + +VL ++PT ELAIQ Sbjct: 48 KDVCACAATGTGKTAAFMLPILERLLYRPTQSPAIRVLVITPTRELAIQ 96 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.029 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F+ +CSPGDPLVLERPP Sbjct: 13 FTSNSCSPGDPLVLERPP 30 >SB_41195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +1 Query: 19 GGRSRTSGSPGLQAFNENH 75 GGRSRTSGSPGLQ F+ +H Sbjct: 9 GGRSRTSGSPGLQEFDPDH 27 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +1 Query: 19 GGRSRTSGSPGLQAFNENH 75 GGRSRTSGSPGLQ F+ +H Sbjct: 9 GGRSRTSGSPGLQEFDASH 27 >SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 36.7 bits (81), Expect = 0.029 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -1 Query: 95 IQLDLAV*FSLKACSPGDPLVLERPP 18 IQ + V + +CSPGDPLVLERPP Sbjct: 13 IQAIVQVIYPSNSCSPGDPLVLERPP 38 >SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 36.7 bits (81), Expect = 0.029 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F+ +CSPGDPLVLERPP Sbjct: 19 FASNSCSPGDPLVLERPP 36 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 36.7 bits (81), Expect = 0.029 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F+ +CSPGDPLVLERPP Sbjct: 27 FTSNSCSPGDPLVLERPP 44 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 36.7 bits (81), Expect = 0.029 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F+ +CSPGDPLVLERPP Sbjct: 1192 FASNSCSPGDPLVLERPP 1209 >SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.7 bits (81), Expect = 0.029 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F+ +CSPGDPLVLERPP Sbjct: 4 FTSNSCSPGDPLVLERPP 21 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.7 bits (81), Expect = 0.029 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F+ +CSPGDPLVLERPP Sbjct: 10 FASNSCSPGDPLVLERPP 27 >SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 36.7 bits (81), Expect = 0.029 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F+ +CSPGDPLVLERPP Sbjct: 9 FASNSCSPGDPLVLERPP 26 >SB_20200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.029 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F+ +CSPGDPLVLERPP Sbjct: 3 FTSNSCSPGDPLVLERPP 20 >SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.7 bits (81), Expect = 0.029 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F+ +CSPGDPLVLERPP Sbjct: 4 FASNSCSPGDPLVLERPP 21 >SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 36.7 bits (81), Expect = 0.029 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F+ +CSPGDPLVLERPP Sbjct: 109 FTSNSCSPGDPLVLERPP 126 >SB_11350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 36.7 bits (81), Expect = 0.029 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F+ +CSPGDPLVLERPP Sbjct: 23 FTSNSCSPGDPLVLERPP 40 >SB_2526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = -1 Query: 95 IQLDLAV*FSLKACSPGDPLVLERPP 18 ++L L + + +CSPGDPLVLERPP Sbjct: 36 VELYLDICHTSNSCSPGDPLVLERPP 61 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 36.3 bits (80), Expect = 0.038 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 83 LAV*FSLKACSPGDPLVLERPP 18 + V F +CSPGDPLVLERPP Sbjct: 510 IVVTFLSNSCSPGDPLVLERPP 531 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 36.3 bits (80), Expect = 0.038 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = -1 Query: 116 VFLYLV*IQLDLAV*FSLKACSPGDPLVLERPP 18 V+ + + L++ + +CSPGDPLVLERPP Sbjct: 22 VYTFKICTSRQLSITSTSNSCSPGDPLVLERPP 54 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 36.3 bits (80), Expect = 0.038 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -1 Query: 83 LAV*FSLKACSPGDPLVLERPP 18 +++ F +CSPGDPLVLERPP Sbjct: 14 ISIAFVSNSCSPGDPLVLERPP 35 >SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.3 bits (80), Expect = 0.038 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 7 FGSNSCSPGDPLVLERPP 24 >SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.3 bits (80), Expect = 0.038 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 16 FQSNSCSPGDPLVLERPP 33 >SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 36.3 bits (80), Expect = 0.038 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 24 FGSNSCSPGDPLVLERPP 41 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 36.3 bits (80), Expect = 0.038 Identities = 20/38 (52%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -1 Query: 128 GLFSVFLYLV*IQLDLAV*-FSLKACSPGDPLVLERPP 18 G+FSVF + I ++ S +CSPGDPLVLERPP Sbjct: 46 GIFSVFGFSGIIFMEGRFPKLSSNSCSPGDPLVLERPP 83 >SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 36.3 bits (80), Expect = 0.038 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 21 FGSNSCSPGDPLVLERPP 38 >SB_13275| Best HMM Match : Phycoerythr_ab (HMM E-Value=0.23) Length = 250 Score = 36.3 bits (80), Expect = 0.038 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = +1 Query: 19 GGRSRTSGSPGLQAFNENHTARS 87 GGRSRTSGSPGLQ F+ N++ S Sbjct: 9 GGRSRTSGSPGLQEFDVNNSIGS 31 >SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.3 bits (80), Expect = 0.038 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 16 FESNSCSPGDPLVLERPP 33 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 19 GGRSRTSGSPGLQAFNEN 72 GGRSRTSGSPGLQ F+ N Sbjct: 9 GGRSRTSGSPGLQEFDHN 26 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 15 FRSNSCSPGDPLVLERPP 32 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 2 FRSNSCSPGDPLVLERPP 19 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 15 FRSNSCSPGDPLVLERPP 32 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -1 Query: 89 LDLAV*FSLKACSPGDPLVLERPP 18 +D + F +CSPGDPLVLERPP Sbjct: 71 IDHELRFLSNSCSPGDPLVLERPP 94 >SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) Length = 923 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 83 LAV*FSLKACSPGDPLVLERPP 18 + V S +CSPGDPLVLERPP Sbjct: 794 MLVAISSNSCSPGDPLVLERPP 815 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 19 FRSNSCSPGDPLVLERPP 36 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 15 FRSNSCSPGDPLVLERPP 32 >SB_18236| Best HMM Match : Histone (HMM E-Value=1.2) Length = 74 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +1 Query: 19 GGRSRTSGSPGLQAFNEN 72 GGRSRTSGSPGLQ F+E+ Sbjct: 9 GGRSRTSGSPGLQEFDES 26 >SB_18140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 19 GGRSRTSGSPGLQAFNENH 75 GGRSRTSGSPGLQ F+ H Sbjct: 9 GGRSRTSGSPGLQEFDVKH 27 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 53 FRSNSCSPGDPLVLERPP 70 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -1 Query: 95 IQLDLAV*FSLKACSPGDPLVLERPP 18 I++ V + +CSPGDPLVLERPP Sbjct: 11 IKMSRKVSITSNSCSPGDPLVLERPP 36 >SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 19 GGRSRTSGSPGLQAFNEN 72 GGRSRTSGSPGLQ F+ N Sbjct: 9 GGRSRTSGSPGLQEFDSN 26 >SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -1 Query: 83 LAV*FSLKACSPGDPLVLERPP 18 L + ++ +CSPGDPLVLERPP Sbjct: 3 LYIFYASNSCSPGDPLVLERPP 24 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 3 SSNSCSPGDPLVLERPP 19 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 12 SSNSCSPGDPLVLERPP 28 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 13 SSNSCSPGDPLVLERPP 29 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 24 SSNSCSPGDPLVLERPP 40 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 141 SSNSCSPGDPLVLERPP 157 >SB_37859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 35.5 bits (78), Expect = 0.067 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 19 GGRSRTSGSPGLQAFNE 69 GGRSRTSGSPGLQ F+E Sbjct: 9 GGRSRTSGSPGLQEFDE 25 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 203 SSNSCSPGDPLVLERPP 219 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 22 SSNSCSPGDPLVLERPP 38 >SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 7 SSNSCSPGDPLVLERPP 23 >SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) Length = 725 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 191 SSNSCSPGDPLVLERPP 207 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 42 SSNSCSPGDPLVLERPP 58 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 35.5 bits (78), Expect = 0.067 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 ++ +CSPGDPLVLERPP Sbjct: 37 YTSNSCSPGDPLVLERPP 54 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 14 FLSNSCSPGDPLVLERPP 31 >SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 5 SSNSCSPGDPLVLERPP 21 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 49 FLSNSCSPGDPLVLERPP 66 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 7 FLSNSCSPGDPLVLERPP 24 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 35.5 bits (78), Expect = 0.067 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 92 QLDLAV*FSLKACSPGDPLVLERPP 18 QLD + +CSPGDPLVLERPP Sbjct: 233 QLDKLKKKTSNSCSPGDPLVLERPP 257 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 14 SSNSCSPGDPLVLERPP 30 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.067 Identities = 17/26 (65%), Positives = 20/26 (76%), Gaps = 1/26 (3%) Frame = -1 Query: 92 QLDLAV*FSLK-ACSPGDPLVLERPP 18 Q+ L V F + +CSPGDPLVLERPP Sbjct: 25 QILLQVGFKVSNSCSPGDPLVLERPP 50 >SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 10 FLSNSCSPGDPLVLERPP 27 >SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 5 SSNSCSPGDPLVLERPP 21 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 5 SSNSCSPGDPLVLERPP 21 >SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.5 bits (78), Expect = 0.067 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 19 GGRSRTSGSPGLQAFNENH 75 GGRSRTSGSPGLQ F+ H Sbjct: 9 GGRSRTSGSPGLQEFDLRH 27 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 35.5 bits (78), Expect = 0.067 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +2 Query: 20 AAALELVDPPGCRLLMKIIR 79 AAALELVDPPGCR +++IR Sbjct: 10 AAALELVDPPGCRNSIEVIR 29 >SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 15 SSNSCSPGDPLVLERPP 31 >SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) Length = 141 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 17 SSNSCSPGDPLVLERPP 33 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 35 SSNSCSPGDPLVLERPP 51 >SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 14 SSNSCSPGDPLVLERPP 30 >SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 4 SSNSCSPGDPLVLERPP 20 >SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 34 FLSNSCSPGDPLVLERPP 51 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 46 FISNSCSPGDPLVLERPP 63 >SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 147 Score = 35.5 bits (78), Expect = 0.067 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -1 Query: 86 DLAV*FSLKACSPGDPLVLERPP 18 DLA+ S +CSPGDPLVLERPP Sbjct: 18 DLALTTS-NSCSPGDPLVLERPP 39 >SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 2 SSNSCSPGDPLVLERPP 18 >SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 2 SSNSCSPGDPLVLERPP 18 >SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 6 SSNSCSPGDPLVLERPP 22 >SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 12 SSNSCSPGDPLVLERPP 28 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 86 SSNSCSPGDPLVLERPP 102 Score = 33.1 bits (72), Expect = 0.36 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +3 Query: 570 DMGKIKVFVLDEADVMINRQGHQDQCIRIHKCLPSTCQ 683 D IK+ VLDEAD M+N+ G ++Q +++ LP Q Sbjct: 32 DTRSIKMLVLDEADEMLNK-GFKEQIYDVYRYLPPATQ 68 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 35.5 bits (78), Expect = 0.067 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 89 LDLAV*FSLKACSPGDPLVLERPP 18 L L V +CSPGDPLVLERPP Sbjct: 59 LALTVFMLSNSCSPGDPLVLERPP 82 >SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) Length = 736 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 611 FLSNSCSPGDPLVLERPP 628 >SB_39773| Best HMM Match : DUF765 (HMM E-Value=4.1) Length = 126 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 3 SSNSCSPGDPLVLERPP 19 >SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 175 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 51 SSNSCSPGDPLVLERPP 67 >SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 6 SSNSCSPGDPLVLERPP 22 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 13 FVSNSCSPGDPLVLERPP 30 >SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) Length = 351 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 227 SSNSCSPGDPLVLERPP 243 >SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 14 SSNSCSPGDPLVLERPP 30 >SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) Length = 274 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 150 SSNSCSPGDPLVLERPP 166 >SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 15 SSNSCSPGDPLVLERPP 31 >SB_29878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 6 SSNSCSPGDPLVLERPP 22 >SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 22 SSNSCSPGDPLVLERPP 38 >SB_28438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 2 SSNSCSPGDPLVLERPP 18 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 7 SSNSCSPGDPLVLERPP 23 >SB_27866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.5 bits (78), Expect = 0.067 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 ++ +CSPGDPLVLERPP Sbjct: 2 YASNSCSPGDPLVLERPP 19 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 24 SSNSCSPGDPLVLERPP 40 >SB_26033| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 2 SSNSCSPGDPLVLERPP 18 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 170 FLSNSCSPGDPLVLERPP 187 >SB_18638| Best HMM Match : DUF765 (HMM E-Value=4) Length = 127 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 3 SSNSCSPGDPLVLERPP 19 >SB_18123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 2 SSNSCSPGDPLVLERPP 18 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 51 FISNSCSPGDPLVLERPP 68 >SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 17 SSNSCSPGDPLVLERPP 33 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 62 FLSNSCSPGDPLVLERPP 79 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 15 SSNSCSPGDPLVLERPP 31 >SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 19 SSNSCSPGDPLVLERPP 35 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 6 FISNSCSPGDPLVLERPP 23 >SB_12393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 11 SSNSCSPGDPLVLERPP 27 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 80 AV*FSLKACSPGDPLVLERPP 18 A+ + +CSPGDPLVLERPP Sbjct: 17 AIDIASNSCSPGDPLVLERPP 37 >SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) Length = 121 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 95 SSNSCSPGDPLVLERPP 111 >SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 F +CSPGDPLVLERPP Sbjct: 35 FLSNSCSPGDPLVLERPP 52 >SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 29 SSNSCSPGDPLVLERPP 45 >SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) Length = 551 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 427 SSNSCSPGDPLVLERPP 443 >SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 12 SSNSCSPGDPLVLERPP 28 >SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 35.5 bits (78), Expect = 0.067 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 19 GGRSRTSGSPGLQAFNE 69 GGRSRTSGSPGLQ F+E Sbjct: 9 GGRSRTSGSPGLQEFDE 25 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -1 Query: 83 LAV*FSLKACSPGDPLVLERPP 18 L + + +CSPGDPLVLERPP Sbjct: 5 LVIRYISNSCSPGDPLVLERPP 26 >SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 68 SLKACSPGDPLVLERPP 18 S +CSPGDPLVLERPP Sbjct: 20 SSNSCSPGDPLVLERPP 36 >SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.5 bits (78), Expect = 0.067 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 ++ +CSPGDPLVLERPP Sbjct: 16 YTSNSCSPGDPLVLERPP 33 >SB_30200| Best HMM Match : P_proprotein (HMM E-Value=0.011) Length = 73 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = +1 Query: 19 GGRSRTSGSPGLQAFNENHTAR 84 GGRSRTSGSPGLQ F+ ++ R Sbjct: 9 GGRSRTSGSPGLQEFDLDYVRR 30 >SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 35.1 bits (77), Expect = 0.088 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 + +CSPGDPLVLERPP Sbjct: 3 YGSNSCSPGDPLVLERPP 20 >SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.1 bits (77), Expect = 0.088 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 + +CSPGDPLVLERPP Sbjct: 10 YQSNSCSPGDPLVLERPP 27 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 35.1 bits (77), Expect = 0.088 Identities = 21/41 (51%), Positives = 25/41 (60%) Frame = +2 Query: 20 AAALELVDPPGCRLLMKIIRQGLVESKLDIEIQRKDPNSPL 142 AAALELVDPPGCR M I L+ S D E + K+ + L Sbjct: 10 AAALELVDPPGCRNSMDDI--ALLSSTKDREKKTKEKTAKL 48 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +2 Query: 20 AAALELVDPPGCRLLMKI 73 AAALELVDPPGCR MK+ Sbjct: 65 AAALELVDPPGCRNSMKV 82 >SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.1 bits (77), Expect = 0.088 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 + +CSPGDPLVLERPP Sbjct: 21 YGSNSCSPGDPLVLERPP 38 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/19 (78%), Positives = 17/19 (89%), Gaps = 1/19 (5%) Frame = -1 Query: 71 FSLK-ACSPGDPLVLERPP 18 FS+ +CSPGDPLVLERPP Sbjct: 30 FSISNSCSPGDPLVLERPP 48 >SB_17566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.1 bits (77), Expect = 0.088 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 + +CSPGDPLVLERPP Sbjct: 8 YGSNSCSPGDPLVLERPP 25 >SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -1 Query: 86 DLAV*FSLKACSPGDPLVLERPP 18 ++ V + +CSPGDPLVLERPP Sbjct: 44 EMEVTHTSNSCSPGDPLVLERPP 66 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 35.1 bits (77), Expect = 0.088 Identities = 19/31 (61%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +2 Query: 20 AAALELVDPPGCRLLMKIIRQGL-VESKLDI 109 AAALELVDPPGCR MK+ + + KLDI Sbjct: 10 AAALELVDPPGCRNSMKMKVESIDGAEKLDI 40 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 14 SCSPGDPLVLERPP 27 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 12 SCSPGDPLVLERPP 25 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 37 SCSPGDPLVLERPP 50 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 28 SCSPGDPLVLERPP 41 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 5 SCSPGDPLVLERPP 18 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 20 SCSPGDPLVLERPP 33 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 29 SCSPGDPLVLERPP 42 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 186 SCSPGDPLVLERPP 199 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 81 SCSPGDPLVLERPP 94 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 17 SCSPGDPLVLERPP 30 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 351 SCSPGDPLVLERPP 364 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 9 SCSPGDPLVLERPP 22 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 8 SCSPGDPLVLERPP 21 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 20 SCSPGDPLVLERPP 33 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 29 SCSPGDPLVLERPP 42 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 13 SCSPGDPLVLERPP 26 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 104 SCSPGDPLVLERPP 117 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 33 SCSPGDPLVLERPP 46 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 9 SCSPGDPLVLERPP 22 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 37 SCSPGDPLVLERPP 50 >SB_56273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 582 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +1 Query: 19 GGRSRTSGSPGLQAFNEN 72 GGRSRTSGSPGLQ F+++ Sbjct: 9 GGRSRTSGSPGLQEFDDD 26 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 6 SCSPGDPLVLERPP 19 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 4 SCSPGDPLVLERPP 17 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 384 SCSPGDPLVLERPP 397 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 26 SCSPGDPLVLERPP 39 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 16 SCSPGDPLVLERPP 29 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 24 SCSPGDPLVLERPP 37 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 33 SCSPGDPLVLERPP 46 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 4 SCSPGDPLVLERPP 17 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 10 SCSPGDPLVLERPP 23 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 24 SCSPGDPLVLERPP 37 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 21 SCSPGDPLVLERPP 34 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 5 SCSPGDPLVLERPP 18 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 9 SCSPGDPLVLERPP 22 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 56 SCSPGDPLVLERPP 69 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 264 SCSPGDPLVLERPP 277 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 27 SCSPGDPLVLERPP 40 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 21 SCSPGDPLVLERPP 34 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 13 SCSPGDPLVLERPP 26 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 13 SCSPGDPLVLERPP 26 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 21 SCSPGDPLVLERPP 34 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 15 SCSPGDPLVLERPP 28 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 165 SCSPGDPLVLERPP 178 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 22 SCSPGDPLVLERPP 35 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 23 SCSPGDPLVLERPP 36 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 19 SCSPGDPLVLERPP 32 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 37 SCSPGDPLVLERPP 50 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 20 SCSPGDPLVLERPP 33 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 66 SCSPGDPLVLERPP 79 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 71 FSLKACSPGDPLVLERPP 18 + KA SPGDPLVLERPP Sbjct: 629 YDTKATSPGDPLVLERPP 646 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 18 SCSPGDPLVLERPP 31 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 7 SCSPGDPLVLERPP 20 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 6 SCSPGDPLVLERPP 19 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 13 SCSPGDPLVLERPP 26 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 50 SCSPGDPLVLERPP 63 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 115 SCSPGDPLVLERPP 128 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 895 SCSPGDPLVLERPP 908 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 16 SCSPGDPLVLERPP 29 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 27 SCSPGDPLVLERPP 40 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 45 SCSPGDPLVLERPP 58 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 96 SCSPGDPLVLERPP 109 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 67 SCSPGDPLVLERPP 80 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 878 SCSPGDPLVLERPP 891 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 9 SCSPGDPLVLERPP 22 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 13 SCSPGDPLVLERPP 26 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 65 SCSPGDPLVLERPP 78 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 7 SCSPGDPLVLERPP 20 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 20 SCSPGDPLVLERPP 33 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 22 SCSPGDPLVLERPP 35 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 66 SCSPGDPLVLERPP 79 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 45 SCSPGDPLVLERPP 58 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 28 SCSPGDPLVLERPP 41 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 41 SCSPGDPLVLERPP 54 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 17 SCSPGDPLVLERPP 30 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 23 SCSPGDPLVLERPP 36 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 26 SCSPGDPLVLERPP 39 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 43 SCSPGDPLVLERPP 56 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 5 SCSPGDPLVLERPP 18 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 42 SCSPGDPLVLERPP 55 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 17 SCSPGDPLVLERPP 30 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 485 SCSPGDPLVLERPP 498 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 4 SCSPGDPLVLERPP 17 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 37 SCSPGDPLVLERPP 50 >SB_37362| Best HMM Match : zf-RNPHF (HMM E-Value=3) Length = 88 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = +1 Query: 19 GGRSRTSGSPGLQAFNENHT 78 GGRSRTSGSPGLQ F+ T Sbjct: 9 GGRSRTSGSPGLQEFDRQGT 28 >SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) Length = 141 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = +1 Query: 19 GGRSRTSGSPGLQAFNENHTAR 84 GGRSRTSGSPGLQ F+ R Sbjct: 65 GGRSRTSGSPGLQEFDNTRLLR 86 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 83 SCSPGDPLVLERPP 96 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 38 SCSPGDPLVLERPP 51 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 63 SCSPGDPLVLERPP 76 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 59 ACSPGDPLVLERPP 18 +CSPGDPLVLERPP Sbjct: 26 SCSPGDPLVLERPP 39 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,989,240 Number of Sequences: 59808 Number of extensions: 643752 Number of successful extensions: 2917 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2759 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2897 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2919714245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -