BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0795 (972 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 151 6e-37 SB_31360| Best HMM Match : No HMM Matches (HMM E-Value=.) 149 4e-36 SB_24678| Best HMM Match : No HMM Matches (HMM E-Value=.) 138 5e-33 SB_24677| Best HMM Match : No HMM Matches (HMM E-Value=.) 138 5e-33 SB_51693| Best HMM Match : Pro_isomerase (HMM E-Value=3.5e-19) 69 6e-12 SB_32917| Best HMM Match : Pro_isomerase (HMM E-Value=5.1e-23) 66 5e-11 SB_25950| Best HMM Match : Pro_isomerase (HMM E-Value=2.5e-24) 63 3e-10 SB_24676| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 7e-06 SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) 48 9e-06 SB_3070| Best HMM Match : Pro_isomerase (HMM E-Value=2.3e-05) 46 6e-05 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 39 0.007 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_23239| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_6440| Best HMM Match : DUF638 (HMM E-Value=6.2) 37 0.021 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.028 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 37 0.028 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 36 0.037 SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 36 0.050 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 35 0.087 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 35 0.11 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 35 0.11 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 35 0.11 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 35 0.11 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) 34 0.15 SB_30140| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 34 0.15 SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 34 0.15 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 34 0.15 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 34 0.20 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 34 0.20 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_21081| Best HMM Match : Pro_isomerase (HMM E-Value=0.11) 34 0.20 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 34 0.20 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 34 0.20 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 34 0.20 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 33 0.26 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 33 0.26 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 33 0.26 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 33 0.26 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 33 0.26 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 33 0.26 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 33 0.26 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 33 0.26 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 33 0.35 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 33 0.35 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 33 0.35 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 33 0.35 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_23941| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 33 0.35 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 33 0.35 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 33 0.35 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 33 0.46 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 33 0.46 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 33 0.46 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 33 0.46 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 33 0.46 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 33 0.46 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 33 0.46 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 33 0.46 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 33 0.46 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 33 0.46 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 33 0.46 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 33 0.46 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 33 0.46 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 33 0.46 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 33 0.46 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 33 0.46 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 33 0.46 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 33 0.46 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 33 0.46 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 33 0.46 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 33 0.46 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 33 0.46 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 33 0.46 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 33 0.46 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 33 0.46 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 33 0.46 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 33 0.46 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 33 0.46 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 33 0.46 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 151 bits (367), Expect = 6e-37 Identities = 67/84 (79%), Positives = 71/84 (84%) Frame = +2 Query: 248 CPGTGEKGFGYKGSIFHRVIPNFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGV 427 C T EKGFGYKGS FHR+IP FM QGGDFT HNGTGGKSIYG KFEDENF LKHTG GV Sbjct: 171 CLCTHEKGFGYKGSSFHRIIPQFMCQGGDFTKHNGTGGKSIYGAKFEDENFVLKHTGAGV 230 Query: 428 LSMANAGADTNGSQFFITTVKTSW 499 LSMAN+G +TNGSQFF+TT KT W Sbjct: 231 LSMANSGPNTNGSQFFLTTEKTDW 254 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/47 (59%), Positives = 39/47 (82%) Frame = +1 Query: 490 DLLAGWRHVVFGNVVEGMEVVKQIETFGSQSGKTSKRIVIKDCGQIA 630 D L G +HVVFGNV+EG +VV+++E GSQSGK SK++VI DCG+++ Sbjct: 253 DWLDG-KHVVFGNVIEGFDVVRKMEAVGSQSGKASKKVVIDDCGELS 298 Score = 55.2 bits (127), Expect = 8e-08 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +3 Query: 147 PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALALARK 269 PRVFFD+T+ + G+IV+ELRSDV P T ENFR L K Sbjct: 137 PRVFFDITIGERSAGRIVMELRSDVVPMTAENFRCLCTHEK 177 >SB_31360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 149 bits (360), Expect = 4e-36 Identities = 66/81 (81%), Positives = 69/81 (85%) Frame = +2 Query: 257 TGEKGFGYKGSIFHRVIPNFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSM 436 TGEKGFGYKGS FHRVIP FM QGGDFT +GTGGKSIYG KF DENF LKHTGPG+LSM Sbjct: 40 TGEKGFGYKGSSFHRVIPGFMCQGGDFTRGDGTGGKSIYGAKFADENFNLKHTGPGILSM 99 Query: 437 ANAGADTNGSQFFITTVKTSW 499 ANAG TNGSQFF+ T KTSW Sbjct: 100 ANAGPGTNGSQFFLCTAKTSW 120 Score = 55.6 bits (128), Expect = 6e-08 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = +1 Query: 508 RHVVFGNVVEGMEVVKQIETFGSQSGKTSKRIVIKDCGQI 627 +HVVFG+V +GM+VVK+IE GS SGKTSK++VI D + Sbjct: 124 KHVVFGSVKDGMDVVKKIEKVGSDSGKTSKKVVIADSASV 163 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +3 Query: 156 FFDVTVDDAPLGKIVIELRSDVTPKTCENFRALALARK 269 +FD+ + AP G+IV+ELR DV PKT ENFRAL K Sbjct: 6 YFDIEIGGAPAGRIVMELRDDVVPKTAENFRALCTGEK 43 >SB_24678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 138 bits (335), Expect = 5e-33 Identities = 61/79 (77%), Positives = 68/79 (86%) Frame = +2 Query: 263 EKGFGYKGSIFHRVIPNFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMAN 442 E+GFGYK SIFHRVI NFM+QGGDFTN +GTGG SIYG F+DENF LKH GPG L MAN Sbjct: 65 EQGFGYKDSIFHRVIKNFMIQGGDFTNKDGTGGYSIYGKYFDDENFNLKHYGPGWLCMAN 124 Query: 443 AGADTNGSQFFITTVKTSW 499 AG +TNGSQF+ITT+KTSW Sbjct: 125 AGKNTNGSQFYITTIKTSW 143 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +3 Query: 150 RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALA 257 +V+ DV++ P G++++ L D PKT NF ALA Sbjct: 27 KVWMDVSIGGQPAGRVILGLFGDTAPKTVANFVALA 62 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 511 HVVFGNVVEGMEVVKQIE 564 H FG V+EGM+VV++IE Sbjct: 148 HTCFGKVLEGMDVVRRIE 165 >SB_24677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 138 bits (335), Expect = 5e-33 Identities = 63/84 (75%), Positives = 68/84 (80%) Frame = +2 Query: 248 CPGTGEKGFGYKGSIFHRVIPNFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGV 427 C +KGFGYK SIFHRVI +FM+QGGDFT +GTGGKSIYG KF DENF L+H G G Sbjct: 79 CTIESQKGFGYKNSIFHRVIQDFMIQGGDFTKGDGTGGKSIYGQKFADENFKLQHYGAGW 138 Query: 428 LSMANAGADTNGSQFFITTVKTSW 499 LSMANAG DTNGSQFFITTVKT W Sbjct: 139 LSMANAGKDTNGSQFFITTVKTPW 162 >SB_51693| Best HMM Match : Pro_isomerase (HMM E-Value=3.5e-19) Length = 99 Score = 68.9 bits (161), Expect = 6e-12 Identities = 32/52 (61%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = +2 Query: 347 NGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSW 499 +GTGG+SI+G +FEDE + L+H P +SMANAG +TNGSQFFIT V T W Sbjct: 2 DGTGGESIWGGEFEDEFHRNLRHDRPYTVSMANAGPNTNGSQFFITVVPTPW 53 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 508 RHVVFGNVVEGMEVVKQI 561 +H VFG VV+GM+V +QI Sbjct: 57 KHTVFGRVVKGMDVAQQI 74 >SB_32917| Best HMM Match : Pro_isomerase (HMM E-Value=5.1e-23) Length = 378 Score = 65.7 bits (153), Expect = 5e-11 Identities = 31/47 (65%), Positives = 34/47 (72%) Frame = +2 Query: 347 NGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 487 NGTGG+SIYG F DE F KH P +LSMAN G +TNGSQFFI V Sbjct: 25 NGTGGESIYGGTFGDECFEFKHERPMLLSMANRGPNTNGSQFFIIHV 71 Score = 37.1 bits (82), Expect = 0.021 Identities = 14/40 (35%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = +1 Query: 511 HVVFGNVVEGMEVVKQIETF-GSQSGKTSKRIVIKDCGQI 627 HVVFG+V++G E+V+QIE+ ++ + + + + +CG++ Sbjct: 70 HVVFGHVIQGEELVRQIESLPTNEKNRPNADVKVSNCGEL 109 >SB_25950| Best HMM Match : Pro_isomerase (HMM E-Value=2.5e-24) Length = 145 Score = 63.3 bits (147), Expect = 3e-10 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = +2 Query: 350 GTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSW 499 G GG+S+YG FEDE+F++ H GV+ MAN G TNGSQF+IT W Sbjct: 46 GIGGESVYGPLFEDEDFSVAHNRRGVVGMANKGRHTNGSQFYITLQPAPW 95 >SB_24676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 48.8 bits (111), Expect = 7e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +2 Query: 434 MANAGADTNGSQFFITTVKTSW 499 MANAG DTNGSQFFITTVKTSW Sbjct: 1 MANAGKDTNGSQFFITTVKTSW 22 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +1 Query: 508 RHVVFGNVVEGMEVVKQIETFGSQSGKTSKRIVIKDCGQI 627 +HVVFG V+EGM+VV+++E + K +I D G + Sbjct: 26 KHVVFGKVLEGMDVVRKLENVNVKGSTPVKTCMIDDSGTL 65 >SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) Length = 741 Score = 48.4 bits (110), Expect = 9e-06 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = +2 Query: 407 KHTGPGVLSMANAGADTNGSQFFITTVKT 493 +H PG+LSMAN+G +TNGSQFFITTV T Sbjct: 188 EHDKPGLLSMANSGPNTNGSQFFITTVPT 216 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/41 (39%), Positives = 27/41 (65%) Frame = +1 Query: 508 RHVVFGNVVEGMEVVKQIETFGSQSGKTSKRIVIKDCGQIA 630 RHVVFG V++GM+VV+++E +I++CG++A Sbjct: 222 RHVVFGKVLKGMDVVRELEATPVDDSSPKSPCIIEECGELA 262 >SB_3070| Best HMM Match : Pro_isomerase (HMM E-Value=2.3e-05) Length = 49 Score = 45.6 bits (103), Expect = 6e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = +2 Query: 425 VLSMANAGADTNGSQFFITTVKTSW 499 +LSMANAG TNGSQFF+ T KTSW Sbjct: 2 ILSMANAGPGTNGSQFFLCTAKTSW 26 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/18 (61%), Positives = 17/18 (94%) Frame = +1 Query: 508 RHVVFGNVVEGMEVVKQI 561 +HVVFG+V +GM+VVK++ Sbjct: 30 KHVVFGSVKDGMDVVKKM 47 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -1 Query: 102 PPQ*QCVSRQCRLVPNSCSPGDPLVLER 19 P + +S + RLV NSCSPGDPLVLER Sbjct: 14 PTRYAILSPRARLVSNSCSPGDPLVLER 41 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = -1 Query: 90 QCVSRQCRLVPNSCSPGDPLVLER 19 +C++ R+V NSCSPGDPLVLER Sbjct: 77 ECLTLTQRIVSNSCSPGDPLVLER 100 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -1 Query: 87 CVSRQCRLVPNSCSPGDPLVLER 19 C Q R+ NSCSPGDPLVLER Sbjct: 15 CFQSQTRVTSNSCSPGDPLVLER 37 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 72 CRLVPNSCSPGDPLVLER 19 C LV NSCSPGDPLVLER Sbjct: 3 CMLVSNSCSPGDPLVLER 20 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 81 SRQCRLVPNSCSPGDPLVLER 19 S C V NSCSPGDPLVLER Sbjct: 8 SNMCSFVSNSCSPGDPLVLER 28 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = -1 Query: 102 PPQ*QCVSRQCRLVPNSCSPGDPLVLER 19 PP + R C + NSCSPGDPLVLER Sbjct: 77 PPNIWDLLRPCIVTSNSCSPGDPLVLER 104 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = -1 Query: 81 SRQCRL-VPNSCSPGDPLVLER 19 S+QC L + NSCSPGDPLVLER Sbjct: 5 SKQCLLEISNSCSPGDPLVLER 26 >SB_23239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 37.5 bits (83), Expect = 0.016 Identities = 26/68 (38%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = +2 Query: 278 YKGSIFHRVIPNFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA-D 454 Y G+ FHRVIP FM+QGG F + + ++E H G L+MA D Sbjct: 60 YAGTQFHRVIPGFMVQGGGF---DADMQQKDTQAPIKNEADNGLHNVRGTLAMARTQVRD 116 Query: 455 TNGSQFFI 478 + SQFFI Sbjct: 117 SATSQFFI 124 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 37.5 bits (83), Expect = 0.016 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 72 CRLVPNSCSPGDPLVLER 19 CR+ NSCSPGDPLVLER Sbjct: 53 CRVPSNSCSPGDPLVLER 70 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/38 (52%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = -1 Query: 123 QCKQFT-KPPQ*QCVSRQ--CRLVPNSCSPGDPLVLER 19 QC ++ PP Q S+ R NSCSPGDPLVLER Sbjct: 58 QCLLYSGNPPSSQVFSQSPLSRFTSNSCSPGDPLVLER 95 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -1 Query: 72 CRLVPNSCSPGDPLVLER 19 C V NSCSPGDPLVLER Sbjct: 5 CEAVSNSCSPGDPLVLER 22 >SB_6440| Best HMM Match : DUF638 (HMM E-Value=6.2) Length = 175 Score = 37.1 bits (82), Expect = 0.021 Identities = 14/40 (35%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = +1 Query: 511 HVVFGNVVEGMEVVKQIETF-GSQSGKTSKRIVIKDCGQI 627 HVVFG+V++G E+V+QIE+ ++ + + + + +CG++ Sbjct: 3 HVVFGHVIQGEELVRQIESLPTNEKNRPNADVKVSNCGEL 42 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 55 FLQPGGSTSSRA 20 FLQPGGSTSSRA Sbjct: 54 FLQPGGSTSSRA 65 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 36.7 bits (81), Expect = 0.028 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 V+ CR NSCSPGDPLVLER Sbjct: 22 VASLCRSRSNSCSPGDPLVLER 43 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 +SR+ + NSCSPGDPLVLER Sbjct: 13 MSRKVSITSNSCSPGDPLVLER 34 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.3 bits (80), Expect = 0.037 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R++ NSCSPGDPLVLER Sbjct: 16 RIISNSCSPGDPLVLER 32 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R+V NSCSPGDPLVLER Sbjct: 3473 RVVSNSCSPGDPLVLER 3489 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 36.3 bits (80), Expect = 0.037 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 + + R + NSCSPGDPLVLER Sbjct: 71 IDHELRFLSNSCSPGDPLVLER 92 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 36.3 bits (80), Expect = 0.037 Identities = 17/25 (68%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = -1 Query: 87 CVSRQCRLVP--NSCSPGDPLVLER 19 C SRQ + NSCSPGDPLVLER Sbjct: 28 CTSRQLSITSTSNSCSPGDPLVLER 52 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 36.3 bits (80), Expect = 0.037 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 VSR+ + NSCSPGDPLVLER Sbjct: 967 VSRRKGWISNSCSPGDPLVLER 988 >SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 36.3 bits (80), Expect = 0.037 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 VS Q + NSCSPGDPLVLER Sbjct: 15 VSNQTKQSSNSCSPGDPLVLER 36 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 36.3 bits (80), Expect = 0.037 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 78 RQCRLVPNSCSPGDPLVLER 19 R CR NSCSPGDPLVLER Sbjct: 26 RICRERSNSCSPGDPLVLER 45 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 75 QCRLVPNSCSPGDPLVLER 19 + LV NSCSPGDPLVLER Sbjct: 21 RAHLVSNSCSPGDPLVLER 39 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = -1 Query: 102 PPQ*QCVSRQCRLVPNSCSPGDPLVLER 19 PP VS L+ NSCSPGDPLVLER Sbjct: 23 PPSRSTVS--ISLISNSCSPGDPLVLER 48 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 35.9 bits (79), Expect = 0.050 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 5/73 (6%) Frame = -3 Query: 223 VTSLLSSITIF-----PSGASSTVTSKNTRGRDILPVLAM*AIYKTTTMTMRLSSMPARA 59 +TS+L +ITI + ++T T T I+ ++ + I T +T+ + ++ Sbjct: 20 ITSILITITIIIIITTTTTTTTTTTITTTTTTIIIIIVIIITIIIITIITIIIITIIIII 79 Query: 58 XFLQPGGSTSSRA 20 FLQPGGSTSSRA Sbjct: 80 EFLQPGGSTSSRA 92 >SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 +S C + NSCSPGDPLVLER Sbjct: 4 LSSLCVFLSNSCSPGDPLVLER 25 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = -1 Query: 102 PPQ*QCVSRQCRLVPNSCSPGDPLVLER 19 PP VS L+ NSCSPGDPLVLER Sbjct: 23 PPSRSTVS--ISLISNSCSPGDPLVLER 48 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = -1 Query: 102 PPQ*QCVSRQCRLVPNSCSPGDPLVLER 19 PP VS L+ NSCSPGDPLVLER Sbjct: 23 PPSRSTVS--ISLISNSCSPGDPLVLER 48 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = -1 Query: 102 PPQ*QCVSRQCRLVPNSCSPGDPLVLER 19 PP VS L+ NSCSPGDPLVLER Sbjct: 23 PPSRSTVS--ISLISNSCSPGDPLVLER 48 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = -1 Query: 102 PPQ*QCVSRQCRLVPNSCSPGDPLVLER 19 PP VS L+ NSCSPGDPLVLER Sbjct: 23 PPSRSTVS--ISLISNSCSPGDPLVLER 48 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 75 QCRLVPNSCSPGDPLVLER 19 +C V NSCSPGDPLVLER Sbjct: 11 RCWQVSNSCSPGDPLVLER 29 >SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 78 RQCRLVPNSCSPGDPLVLER 19 RQ + NSCSPGDPLVLER Sbjct: 8 RQLKKASNSCSPGDPLVLER 27 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = -1 Query: 102 PPQ*QCVSRQCRLVPNSCSPGDPLVLER 19 PP VS L+ NSCSPGDPLVLER Sbjct: 23 PPSRSTVS--ISLISNSCSPGDPLVLER 48 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = -1 Query: 102 PPQ*QCVSRQCRLVPNSCSPGDPLVLER 19 PP VS L+ NSCSPGDPLVLER Sbjct: 23 PPSRSTVS--ISLISNSCSPGDPLVLER 48 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = -1 Query: 102 PPQ*QCVSRQCRLVPNSCSPGDPLVLER 19 PP VS L+ NSCSPGDPLVLER Sbjct: 21 PPSRSTVS--ISLISNSCSPGDPLVLER 46 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 LV NSCSPGDPLVLER Sbjct: 3 LVSNSCSPGDPLVLER 18 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 LV NSCSPGDPLVLER Sbjct: 17 LVSNSCSPGDPLVLER 32 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 75 QCRLVPNSCSPGDPLVLER 19 Q R + NSCSPGDPLVLER Sbjct: 6 QIRGISNSCSPGDPLVLER 24 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 LV NSCSPGDPLVLER Sbjct: 9 LVSNSCSPGDPLVLER 24 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 35.5 bits (78), Expect = 0.066 Identities = 18/32 (56%), Positives = 21/32 (65%), Gaps = 3/32 (9%) Frame = -1 Query: 105 KPPQ*QCVSRQCRLVP---NSCSPGDPLVLER 19 + P+ Q S R +P NSCSPGDPLVLER Sbjct: 42 RSPRGQRQSENLRTIPPVSNSCSPGDPLVLER 73 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 LV NSCSPGDPLVLER Sbjct: 2 LVSNSCSPGDPLVLER 17 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 LV NSCSPGDPLVLER Sbjct: 26 LVSNSCSPGDPLVLER 41 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L+ NSCSPGDPLVLER Sbjct: 17 LISNSCSPGDPLVLER 32 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 75 QCRLVPNSCSPGDPLVLER 19 Q ++ NSCSPGDPLVLER Sbjct: 116 QKEIISNSCSPGDPLVLER 134 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L+ NSCSPGDPLVLER Sbjct: 37 LISNSCSPGDPLVLER 52 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 35.1 bits (77), Expect = 0.087 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R V NSCSPGDPLVLER Sbjct: 182 RRVSNSCSPGDPLVLER 198 >SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.1 bits (77), Expect = 0.087 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 +S C+L NSCSPGDPLVLER Sbjct: 1 MSNWCKL-SNSCSPGDPLVLER 21 >SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) Length = 428 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 72 CRLVPNSCSPGDPLVLER 19 C + NSCSPGDPLVLER Sbjct: 157 CEVGSNSCSPGDPLVLER 174 >SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.1 bits (77), Expect = 0.087 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 RL NSCSPGDPLVLER Sbjct: 2 RLSSNSCSPGDPLVLER 18 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L+ NSCSPGDPLVLER Sbjct: 8 LISNSCSPGDPLVLER 23 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 35.1 bits (77), Expect = 0.087 Identities = 17/23 (73%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = -1 Query: 81 SRQCRL--VPNSCSPGDPLVLER 19 SR RL + NSCSPGDPLVLER Sbjct: 144 SRNSRLEKISNSCSPGDPLVLER 166 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -1 Query: 90 QCVSRQCRLVPNSCSPGDPLVLER 19 Q + + NSCSPGDPLVLER Sbjct: 19 QIAEKHVKFTSNSCSPGDPLVLER 42 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R+ NSCSPGDPLVLER Sbjct: 24 RITSNSCSPGDPLVLER 40 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L+ NSCSPGDPLVLER Sbjct: 33 LISNSCSPGDPLVLER 48 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L+ NSCSPGDPLVLER Sbjct: 24 LISNSCSPGDPLVLER 39 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.1 bits (77), Expect = 0.087 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R V NSCSPGDPLVLER Sbjct: 2 RRVSNSCSPGDPLVLER 18 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L+ NSCSPGDPLVLER Sbjct: 40 LISNSCSPGDPLVLER 55 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.1 bits (77), Expect = 0.087 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 V RQ NSCSPGDPLVLER Sbjct: 17 VERQHVAASNSCSPGDPLVLER 38 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L+ NSCSPGDPLVLER Sbjct: 70 LISNSCSPGDPLVLER 85 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L+ NSCSPGDPLVLER Sbjct: 34 LISNSCSPGDPLVLER 49 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L+ NSCSPGDPLVLER Sbjct: 21 LISNSCSPGDPLVLER 36 >SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.1 bits (77), Expect = 0.087 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 +S R NSCSPGDPLVLER Sbjct: 9 ISANIRNTSNSCSPGDPLVLER 30 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L+ NSCSPGDPLVLER Sbjct: 16 LISNSCSPGDPLVLER 31 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 ++V NSCSPGDPLVLER Sbjct: 26 KVVSNSCSPGDPLVLER 42 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R + NSCSPGDPLVLER Sbjct: 8 RYISNSCSPGDPLVLER 24 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 +V NSCSPGDPLVLER Sbjct: 347 IVSNSCSPGDPLVLER 362 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R+ NSCSPGDPLVLER Sbjct: 51 RVASNSCSPGDPLVLER 67 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 78 RQCRLVPNSCSPGDPLVLER 19 R V NSCSPGDPLVLER Sbjct: 10 RSASQVSNSCSPGDPLVLER 29 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -1 Query: 90 QCVSRQCRLVPNSCSPGDPLVLER 19 Q +C NSCSPGDPLVLER Sbjct: 4 QISKNRCVTSSNSCSPGDPLVLER 27 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 78 RQCRLVPNSCSPGDPLVLER 19 +Q + NSCSPGDPLVLER Sbjct: 37 KQANVPSNSCSPGDPLVLER 56 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R+ NSCSPGDPLVLER Sbjct: 16 RVTSNSCSPGDPLVLER 32 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 +V NSCSPGDPLVLER Sbjct: 77 IVSNSCSPGDPLVLER 92 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R V NSCSPGDPLVLER Sbjct: 62 RPVSNSCSPGDPLVLER 78 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 +V NSCSPGDPLVLER Sbjct: 11 MVSNSCSPGDPLVLER 26 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 78 RQCRLVPNSCSPGDPLVLER 19 R L+ NSCSPGDPLVLER Sbjct: 2 RTAILLSNSCSPGDPLVLER 21 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 +V NSCSPGDPLVLER Sbjct: 1 MVSNSCSPGDPLVLER 16 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R + NSCSPGDPLVLER Sbjct: 30 RSISNSCSPGDPLVLER 46 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/23 (69%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = -1 Query: 84 VSRQCRLVP-NSCSPGDPLVLER 19 ++ Q +LV NSCSPGDPLVLER Sbjct: 13 INTQSKLVASNSCSPGDPLVLER 35 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 +V NSCSPGDPLVLER Sbjct: 13 IVSNSCSPGDPLVLER 28 >SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -1 Query: 72 CRLVPNSCSPGDPLVLER 19 C NSCSPGDPLVLER Sbjct: 2 CIFASNSCSPGDPLVLER 19 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 +V NSCSPGDPLVLER Sbjct: 6 IVSNSCSPGDPLVLER 21 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 81 SRQCRLVPNSCSPGDPLVLER 19 S + L NSCSPGDPLVLER Sbjct: 6 STEVYLASNSCSPGDPLVLER 26 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 +V NSCSPGDPLVLER Sbjct: 1 MVSNSCSPGDPLVLER 16 >SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -1 Query: 90 QCVSRQCRLVPNSCSPGDPLVLER 19 Q V + + NSCSPGDPLVLER Sbjct: 29 QAVEKFKKCTSNSCSPGDPLVLER 52 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -1 Query: 72 CRLVPNSCSPGDPLVLER 19 C NSCSPGDPLVLER Sbjct: 7 CYKTSNSCSPGDPLVLER 24 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 78 RQCRLVPNSCSPGDPLVLER 19 R+ + NSCSPGDPLVLER Sbjct: 18 RRSKRASNSCSPGDPLVLER 37 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L+ NSCSPGDPLVLER Sbjct: 62 LLSNSCSPGDPLVLER 77 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -1 Query: 78 RQCRLVPNSCSPGDPLVLER 19 R +++ NSCSPGDPLVLER Sbjct: 8 RITKVLSNSCSPGDPLVLER 27 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -1 Query: 72 CRLVPNSCSPGDPLVLER 19 C NSCSPGDPLVLER Sbjct: 35 CFYTSNSCSPGDPLVLER 52 >SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R NSCSPGDPLVLER Sbjct: 18 RFASNSCSPGDPLVLER 34 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 14 IISNSCSPGDPLVLER 29 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 13 IISNSCSPGDPLVLER 28 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 +V NSCSPGDPLVLER Sbjct: 7 VVSNSCSPGDPLVLER 22 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L+ NSCSPGDPLVLER Sbjct: 54 LLSNSCSPGDPLVLER 69 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L+ NSCSPGDPLVLER Sbjct: 2 LLSNSCSPGDPLVLER 17 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +3 Query: 21 ALELVDPPGCRNXARAGIDE 80 ALELVDPPGCRN + G +E Sbjct: 12 ALELVDPPGCRNSIKYGQEE 31 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R + NSCSPGDPLVLER Sbjct: 54 RALSNSCSPGDPLVLER 70 >SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R+ NSCSPGDPLVLER Sbjct: 11 RIQSNSCSPGDPLVLER 27 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 +V NSCSPGDPLVLER Sbjct: 19 VVSNSCSPGDPLVLER 34 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 5 IISNSCSPGDPLVLER 20 >SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 + R+ + NSCSPGDPLVLER Sbjct: 6 LDRESYALSNSCSPGDPLVLER 27 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 81 SRQCRLVPNSCSPGDPLVLER 19 +R + NSCSPGDPLVLER Sbjct: 20 TRHLQAASNSCSPGDPLVLER 40 >SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) Length = 263 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 72 CRLVPNSCSPGDPLVLER 19 C + NSCSPGDPLVLER Sbjct: 12 CGELSNSCSPGDPLVLER 29 >SB_30140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 72 CRLVPNSCSPGDPLVLER 19 C + NSCSPGDPLVLER Sbjct: 7 CYELSNSCSPGDPLVLER 24 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 + R+ + NSCSPGDPLVLER Sbjct: 109 IKRRLLGISNSCSPGDPLVLER 130 >SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R NSCSPGDPLVLER Sbjct: 8 RFASNSCSPGDPLVLER 24 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 1 MISNSCSPGDPLVLER 16 >SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) Length = 167 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 81 SRQCRLVPNSCSPGDPLVLER 19 +RQ NSCSPGDPLVLER Sbjct: 37 NRQLLNASNSCSPGDPLVLER 57 >SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/34 (55%), Positives = 22/34 (64%) Frame = -1 Query: 120 CKQFTKPPQ*QCVSRQCRLVPNSCSPGDPLVLER 19 C FT PQ + S+ + NSCSPGDPLVLER Sbjct: 2 CFMFT--PQREKTSKH-KAKSNSCSPGDPLVLER 32 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/22 (68%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 81 SRQCRL-VPNSCSPGDPLVLER 19 S +C + + NSCSPGDPLVLER Sbjct: 83 SAECVMTISNSCSPGDPLVLER 104 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L+ NSCSPGDPLVLER Sbjct: 1 LLSNSCSPGDPLVLER 16 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 4 IISNSCSPGDPLVLER 19 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/17 (94%), Positives = 16/17 (94%), Gaps = 1/17 (5%) Frame = -1 Query: 66 LVP-NSCSPGDPLVLER 19 LVP NSCSPGDPLVLER Sbjct: 27 LVPSNSCSPGDPLVLER 43 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 78 RQCRLVPNSCSPGDPLVLER 19 ++ V NSCSPGDPLVLER Sbjct: 18 KRVNAVSNSCSPGDPLVLER 37 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L+ NSCSPGDPLVLER Sbjct: 7 LLSNSCSPGDPLVLER 22 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 +L NSCSPGDPLVLER Sbjct: 660 QLASNSCSPGDPLVLER 676 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 13 IISNSCSPGDPLVLER 28 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 V + V NSCSPGDPLVLER Sbjct: 10 VDKIADFVSNSCSPGDPLVLER 31 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 26 IISNSCSPGDPLVLER 41 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 ++ + L NSCSPGDPLVLER Sbjct: 5 MAHESGLTSNSCSPGDPLVLER 26 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 30 VSNSCSPGDPLVLER 44 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 7 VSNSCSPGDPLVLER 21 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R NSCSPGDPLVLER Sbjct: 15 RTTSNSCSPGDPLVLER 31 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 2 VSNSCSPGDPLVLER 16 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L NSCSPGDPLVLER Sbjct: 15 LTSNSCSPGDPLVLER 30 >SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 57 NSCSPGDPLVLERXA 13 NSCSPGDPLVLER A Sbjct: 56 NSCSPGDPLVLERAA 70 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = -1 Query: 81 SRQCRLVPNSCSPGDPLVLER 19 +++ ++ NSCSPGDPLVLER Sbjct: 77 AKRQQMASNSCSPGDPLVLER 97 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 40 VSNSCSPGDPLVLER 54 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 117 VSNSCSPGDPLVLER 131 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 34 VSNSCSPGDPLVLER 48 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 1066 VSNSCSPGDPLVLER 1080 >SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) Length = 258 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = -1 Query: 120 CKQFTKPPQ*QCVSRQCRLVPNSCSPGDPLVLER 19 C+ F+ + Q R + NSCSPGDPLVLER Sbjct: 115 CEDFSPCGESQTNLRARIVGSNSCSPGDPLVLER 148 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 14 VISNSCSPGDPLVLER 29 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 +S + NSCSPGDPLVLER Sbjct: 9 ISANIKFRSNSCSPGDPLVLER 30 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L NSCSPGDPLVLER Sbjct: 78 LTSNSCSPGDPLVLER 93 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 3 VSNSCSPGDPLVLER 17 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 214 VSNSCSPGDPLVLER 228 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 17 KITSNSCSPGDPLVLER 33 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 +L NSCSPGDPLVLER Sbjct: 33 KLSSNSCSPGDPLVLER 49 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 32 VSNSCSPGDPLVLER 46 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L NSCSPGDPLVLER Sbjct: 5 LASNSCSPGDPLVLER 20 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 5 VSNSCSPGDPLVLER 19 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 75 QCRLVPNSCSPGDPLVLER 19 Q L NSCSPGDPLVLER Sbjct: 3 QTGLPSNSCSPGDPLVLER 21 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 3 VSNSCSPGDPLVLER 17 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 7 VSNSCSPGDPLVLER 21 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 81 SRQCRLVPNSCSPGDPLVLER 19 S++ + NSCSPGDPLVLER Sbjct: 41 SKKNFFISNSCSPGDPLVLER 61 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 27 KIASNSCSPGDPLVLER 43 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L NSCSPGDPLVLER Sbjct: 6 LASNSCSPGDPLVLER 21 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 19 VSNSCSPGDPLVLER 33 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -1 Query: 72 CRLVPNSCSPGDPLVLER 19 C NSCSPGDPLVLER Sbjct: 3 CASSSNSCSPGDPLVLER 20 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 11 VSNSCSPGDPLVLER 25 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 +L NSCSPGDPLVLER Sbjct: 65 KLSSNSCSPGDPLVLER 81 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 25 VSNSCSPGDPLVLER 39 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 15 VSNSCSPGDPLVLER 29 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L NSCSPGDPLVLER Sbjct: 17 LASNSCSPGDPLVLER 32 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 31 VSNSCSPGDPLVLER 45 >SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1651 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 410 HTGPGVLSMANAGADTNGSQFFI 478 H G +SMAN G ++NGSQFFI Sbjct: 301 HNARGTVSMANNGPNSNGSQFFI 323 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 41 VSNSCSPGDPLVLER 55 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R + NSCSPGDPLVLER Sbjct: 21 RSLSNSCSPGDPLVLER 37 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 6 VSNSCSPGDPLVLER 20 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 5 VISNSCSPGDPLVLER 20 >SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 V+ C L NSCSPGDPLVLER Sbjct: 2 VNLHCSL-SNSCSPGDPLVLER 22 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 15 VSNSCSPGDPLVLER 29 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L NSCSPGDPLVLER Sbjct: 37 LTSNSCSPGDPLVLER 52 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 18 VSNSCSPGDPLVLER 32 >SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 2 KITSNSCSPGDPLVLER 18 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L NSCSPGDPLVLER Sbjct: 20 LASNSCSPGDPLVLER 35 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L NSCSPGDPLVLER Sbjct: 11 LTSNSCSPGDPLVLER 26 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 30 VSNSCSPGDPLVLER 44 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 32 VSNSCSPGDPLVLER 46 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 17 VSNSCSPGDPLVLER 31 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 14 VSNSCSPGDPLVLER 28 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 34 VSNSCSPGDPLVLER 48 >SB_21081| Best HMM Match : Pro_isomerase (HMM E-Value=0.11) Length = 48 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 189 GKIVIELRSDVTPKTCENFRALALARK 269 G+++ EL +D PKT ENFRAL K Sbjct: 2 GRVLFELFADKVPKTAENFRALCTGEK 28 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L NSCSPGDPLVLER Sbjct: 88 LTSNSCSPGDPLVLER 103 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L NSCSPGDPLVLER Sbjct: 11 LASNSCSPGDPLVLER 26 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 17 VISNSCSPGDPLVLER 32 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R+ NSCSPGDPLVLER Sbjct: 17 RVSSNSCSPGDPLVLER 33 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 18 VSNSCSPGDPLVLER 32 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L NSCSPGDPLVLER Sbjct: 3 LASNSCSPGDPLVLER 18 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L NSCSPGDPLVLER Sbjct: 15 LTSNSCSPGDPLVLER 30 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 27 VSNSCSPGDPLVLER 41 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L NSCSPGDPLVLER Sbjct: 7 LASNSCSPGDPLVLER 22 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 193 VSNSCSPGDPLVLER 207 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 78 RQCRLVPNSCSPGDPLVLER 19 R+ + NSCSPGDPLVLER Sbjct: 46 RRVYVTSNSCSPGDPLVLER 65 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 9 VSNSCSPGDPLVLER 23 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 25 VISNSCSPGDPLVLER 40 >SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R+ NSCSPGDPLVLER Sbjct: 14 RVESNSCSPGDPLVLER 30 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 V +Q + NSCSPGDPLVLER Sbjct: 28 VPKQESIRSNSCSPGDPLVLER 49 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L NSCSPGDPLVLER Sbjct: 96 LASNSCSPGDPLVLER 111 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 L NSCSPGDPLVLER Sbjct: 4 LASNSCSPGDPLVLER 19 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 V NSCSPGDPLVLER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/24 (66%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = -1 Query: 87 CVSR-QCRLVPNSCSPGDPLVLER 19 C+ R + R NSCSPGDPLVLER Sbjct: 2 CLCRMKTREKSNSCSPGDPLVLER 25 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 5 ISNSCSPGDPLVLER 19 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/18 (83%), Positives = 17/18 (94%), Gaps = 1/18 (5%) Frame = -1 Query: 69 RLVP-NSCSPGDPLVLER 19 +L+P NSCSPGDPLVLER Sbjct: 23 QLLPSNSCSPGDPLVLER 40 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 101 ISNSCSPGDPLVLER 115 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 261 ISNSCSPGDPLVLER 275 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 16 ISNSCSPGDPLVLER 30 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 13 ILSNSCSPGDPLVLER 28 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R NSCSPGDPLVLER Sbjct: 51 RSASNSCSPGDPLVLER 67 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 21 ISNSCSPGDPLVLER 35 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R NSCSPGDPLVLER Sbjct: 31 RKTSNSCSPGDPLVLER 47 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 75 QCRLVPNSCSPGDPLVLER 19 Q R NSCSPGDPLVLER Sbjct: 18 QRRRESNSCSPGDPLVLER 36 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 59 ISNSCSPGDPLVLER 73 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 9 ISNSCSPGDPLVLER 23 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 3 ISNSCSPGDPLVLER 17 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 55 ILSNSCSPGDPLVLER 70 >SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 +S + NSCSPGDPLVLER Sbjct: 9 ISANIKAGSNSCSPGDPLVLER 30 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 13 ISNSCSPGDPLVLER 27 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 4 ISNSCSPGDPLVLER 18 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 52 ISNSCSPGDPLVLER 66 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 51 ISNSCSPGDPLVLER 65 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 16 ISNSCSPGDPLVLER 30 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -1 Query: 78 RQCRLVPNSCSPGDPLVLER 19 R+ NSCSPGDPLVLER Sbjct: 61 RKSSTTSNSCSPGDPLVLER 80 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/23 (69%), Positives = 17/23 (73%), Gaps = 3/23 (13%) Frame = -1 Query: 78 RQCRLVP---NSCSPGDPLVLER 19 R C +P NSCSPGDPLVLER Sbjct: 2 RPCVTMPRASNSCSPGDPLVLER 24 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 21 ISNSCSPGDPLVLER 35 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 4 ISNSCSPGDPLVLER 18 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 7 ISNSCSPGDPLVLER 21 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 4 ISNSCSPGDPLVLER 18 >SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R + NSCSPGDPLVLER Sbjct: 21 RHLSNSCSPGDPLVLER 37 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 32 ISNSCSPGDPLVLER 46 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 1/22 (4%) Frame = -1 Query: 81 SRQCRLV-PNSCSPGDPLVLER 19 SR RL NSCSPGDPLVLER Sbjct: 57 SRAIRLSRSNSCSPGDPLVLER 78 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 18 ISNSCSPGDPLVLER 32 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 32 ISNSCSPGDPLVLER 46 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 84 VSRQCRLVPNSCSPGDPLVLER 19 VS + + NSCSPGDPLVLER Sbjct: 6 VSIKQQATSNSCSPGDPLVLER 27 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 6 ISNSCSPGDPLVLER 20 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -1 Query: 66 LVPNSCSPGDPLVLER 19 ++ NSCSPGDPLVLER Sbjct: 65 MLSNSCSPGDPLVLER 80 >SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 +++ NSCSPGDPLVLER Sbjct: 12 QVLSNSCSPGDPLVLER 28 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 1 ISNSCSPGDPLVLER 15 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 5 ISNSCSPGDPLVLER 19 >SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 5 ISNSCSPGDPLVLER 19 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 69 RLVPNSCSPGDPLVLER 19 R+ NSCSPGDPLVLER Sbjct: 320 RVRSNSCSPGDPLVLER 336 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/21 (76%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = -1 Query: 75 QCR--LVPNSCSPGDPLVLER 19 QC L NSCSPGDPLVLER Sbjct: 1 QCHVSLSSNSCSPGDPLVLER 21 >SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 63 VPNSCSPGDPLVLER 19 + NSCSPGDPLVLER Sbjct: 2 ISNSCSPGDPLVLER 16 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,288,036 Number of Sequences: 59808 Number of extensions: 701945 Number of successful extensions: 3945 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3943 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2872045441 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -