BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0794 (1016 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_1027 - 29826076-29826189,29827304-29827476,29827659-29827710 29 4.5 01_06_1620 + 38697960-38698131,38698532-38700732 29 5.9 >03_05_1027 - 29826076-29826189,29827304-29827476,29827659-29827710 Length = 112 Score = 29.5 bits (63), Expect = 4.5 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -1 Query: 317 GIERGW--ECAPPADTQHTXHATRRRESPACRRGSTALESACELSSQQTQTQ 168 G+ER W E A P ++ H + AC + + + E CE ++ Q Q Sbjct: 2 GLERTWCLEIAQPEESDHHIKLDISIYTKACMKDNYSTEKQCEKEEEEEQKQ 53 >01_06_1620 + 38697960-38698131,38698532-38700732 Length = 790 Score = 29.1 bits (62), Expect = 5.9 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = +1 Query: 415 DLQQKWVPLVYGPVVGRFLERGXLXAQ--WKFRXRPSPNCKELQIIPEHAAAYALLXN 582 D W+P G + R + G + WK R P+P +Q+ P A Y LL N Sbjct: 158 DFTDTWLP---GNKLSRNKKTGVIKRMISWKDRADPAPGMFSIQLDPSGATQYILLWN 212 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,960,108 Number of Sequences: 37544 Number of extensions: 321147 Number of successful extensions: 977 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 947 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 977 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2998973440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -