BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0794 (1016 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 36 0.052 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.069 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.069 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.069 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 35 0.091 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 35 0.091 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 34 0.16 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 34 0.16 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 34 0.16 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 34 0.16 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_9536| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 34 0.21 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 34 0.21 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_19807| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_719| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 33 0.28 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 33 0.28 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) 33 0.28 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_12393| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 33 0.37 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_40640| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 33 0.37 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 33 0.37 SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 33 0.49 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 33 0.49 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 33 0.49 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 33 0.49 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_31452| Best HMM Match : Telo_bind (HMM E-Value=3.2) 33 0.49 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) 33 0.49 SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_11166| Best HMM Match : CARD (HMM E-Value=0.001) 33 0.49 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_5594| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_1318| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.49 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_53920| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_35386| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_32058| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_29960| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_27752| Best HMM Match : ASC (HMM E-Value=3.7e-07) 32 0.64 SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_1937| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 32 0.85 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 32 0.85 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 32 0.85 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_4676| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 32 0.85 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_23941| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) 32 0.85 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 31 1.1 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 31 1.1 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_42354| Best HMM Match : GETHR (HMM E-Value=5.3) 31 1.1 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_25836| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_18165| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_17566| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_12870| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 31 1.1 SB_2526| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 31 1.1 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 31 1.5 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 31 1.5 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 31 1.5 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 31 1.5 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 31 1.5 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 31 1.5 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 31 1.5 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 31 1.5 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 31 1.5 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 31 1.5 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 31 1.5 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 31 1.5 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 31 1.5 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 31 1.5 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 31 1.5 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 31 1.5 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 31 1.5 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 31 1.5 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 31 1.5 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 31 1.5 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 31 1.5 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 31 1.5 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 31 1.5 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 31 1.5 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 31 1.5 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 31 1.5 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 31 1.5 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 31 1.5 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 31 1.5 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 31 1.5 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 37.9 bits (84), Expect = 0.013 Identities = 18/32 (56%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = -2 Query: 112 QQSLRRTELRDNAKR-TGTXSPGDPLVLERPP 20 +Q LR E+ +NA + + SPGDPLVLERPP Sbjct: 45 EQVLRTLEILENAANGSNSCSPGDPLVLERPP 76 >SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = -2 Query: 103 LRRTELRDNAKRTGTXSPGDPLVLERPP 20 +R LR K + + SPGDPLVLERPP Sbjct: 2 IREERLRQLKKASNSCSPGDPLVLERPP 29 >SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 N KR+ + SPGDPLVLERPP Sbjct: 2 NKKRSNSCSPGDPLVLERPP 21 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 36.3 bits (80), Expect = 0.039 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 NA R+ + SPGDPLVLERPP Sbjct: 10 NAVRSNSCSPGDPLVLERPP 29 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.9 bits (79), Expect = 0.052 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 NAK + + SPGDPLVLERPP Sbjct: 15 NAKVSNSCSPGDPLVLERPP 34 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 35.9 bits (79), Expect = 0.052 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -2 Query: 112 QQSLRRTELRDNAKRTGTXSPGDPLVLERPP 20 + L+ + +N + + + SPGDPLVLERPP Sbjct: 57 KSDLKHLRMIENRRGSNSCSPGDPLVLERPP 87 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 35.5 bits (78), Expect = 0.069 Identities = 21/58 (36%), Positives = 29/58 (50%) Frame = -2 Query: 193 CHRNKHKHKMQSRDEHFLY*LLQTGH*QQSLRRTELRDNAKRTGTXSPGDPLVLERPP 20 C+ N+ + Q R + LL+ QQ + L + + SPGDPLVLERPP Sbjct: 5 CNNNRDNTRSQVRSRNSNRWLLR----QQRQPQRHLSHKRSSSNSCSPGDPLVLERPP 58 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.5 bits (78), Expect = 0.069 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -2 Query: 76 AKRTGTXSPGDPLVLERPP 20 +KR+ + SPGDPLVLERPP Sbjct: 24 SKRSNSCSPGDPLVLERPP 42 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.5 bits (78), Expect = 0.069 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -2 Query: 103 LRRTELRDNAKRTGTXSPGDPLVLERPP 20 LRR+ + D R+ + SPGDPLVLERPP Sbjct: 4 LRRSLVTDEI-RSNSCSPGDPLVLERPP 30 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 35.1 bits (77), Expect = 0.091 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 KR+ + SPGDPLVLERPP Sbjct: 874 KRSNSCSPGDPLVLERPP 891 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.1 bits (77), Expect = 0.091 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = -2 Query: 94 TELRDNAKRTGTXSPGDPLVLERPP 20 T + ++ R+ + SPGDPLVLERPP Sbjct: 14 TRVTNSRPRSNSCSPGDPLVLERPP 38 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 35.1 bits (77), Expect = 0.091 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = -2 Query: 100 RRTELRDNAKRTGTXSPGDPLVLERPP 20 ++ ++D K + + SPGDPLVLERPP Sbjct: 41 KKGPVQDEIKISNSCSPGDPLVLERPP 67 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.1 bits (77), Expect = 0.091 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = -2 Query: 82 DNAKRTGTXSPGDPLVLERPP 20 + ++R+ + SPGDPLVLERPP Sbjct: 4 EKSRRSNSCSPGDPLVLERPP 24 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.1 bits (77), Expect = 0.091 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 KR+ + SPGDPLVLERPP Sbjct: 15 KRSNSCSPGDPLVLERPP 32 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 35.1 bits (77), Expect = 0.091 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 KR+ + SPGDPLVLERPP Sbjct: 43 KRSNSCSPGDPLVLERPP 60 >SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = -2 Query: 112 QQSLRRTELRDNAKRTGTXSPGDPLVLERPP 20 Q R R A + + SPGDPLVLERPP Sbjct: 32 QSGCARKRARAEAALSNSCSPGDPLVLERPP 62 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.1 bits (77), Expect = 0.091 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 KR+ + SPGDPLVLERPP Sbjct: 23 KRSNSCSPGDPLVLERPP 40 >SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 35.1 bits (77), Expect = 0.091 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 +AK + + SPGDPLVLERPP Sbjct: 25 SAKESNSCSPGDPLVLERPP 44 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 35.1 bits (77), Expect = 0.091 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -2 Query: 130 LQTGH*QQSLRRTELRDNAKRTGTXSPGDPLVLERPP 20 L H + L L D + + SPGDPLVLERPP Sbjct: 77 LDAAHQELELAADALGDAQPPSNSCSPGDPLVLERPP 113 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 35.1 bits (77), Expect = 0.091 Identities = 18/32 (56%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = -2 Query: 112 QQSLR-RTELRDNAKRTGTXSPGDPLVLERPP 20 +Q LR R R +R+ + SPGDPLVLERPP Sbjct: 16 RQRLRVRLRYRICRERSNSCSPGDPLVLERPP 47 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = -2 Query: 118 H*QQSLRRTELRDNAK--RTGTXSPGDPLVLERPP 20 H Q+ + ++ N K R+ + SPGDPLVLERPP Sbjct: 21 HGQKPMAPNQIWKNHKNYRSNSCSPGDPLVLERPP 55 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -2 Query: 85 RDNAKRTGTXSPGDPLVLERPP 20 +D +K + + SPGDPLVLERPP Sbjct: 29 QDISKTSNSCSPGDPLVLERPP 50 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -2 Query: 100 RRTELRDNAKRTGTXSPGDPLVLERPP 20 ++TE +A + + SPGDPLVLERPP Sbjct: 9 KKTETGRSACPSNSCSPGDPLVLERPP 35 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/29 (51%), Positives = 23/29 (79%) Frame = -2 Query: 106 SLRRTELRDNAKRTGTXSPGDPLVLERPP 20 ++RR ++ A+++ + SPGDPLVLERPP Sbjct: 12 NIRRPTIQ--ARKSNSCSPGDPLVLERPP 38 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -2 Query: 100 RRTELRDNAKRTGTXSPGDPLVLERPP 20 +R + R R+ + SPGDPLVLERPP Sbjct: 53 KRKDKRLGHARSNSCSPGDPLVLERPP 79 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/31 (48%), Positives = 24/31 (77%) Frame = -2 Query: 112 QQSLRRTELRDNAKRTGTXSPGDPLVLERPP 20 ++S +++EL + + + + SPGDPLVLERPP Sbjct: 1053 ERSAKKSELEEK-EVSNSCSPGDPLVLERPP 1082 >SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 82 DNAKRTGTXSPGDPLVLERPP 20 D K + + SPGDPLVLERPP Sbjct: 6 DGIKTSNSCSPGDPLVLERPP 26 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -2 Query: 88 LRDNAKRTGTXSPGDPLVLERPP 20 L+ +R+ + SPGDPLVLERPP Sbjct: 104 LKHRDQRSNSCSPGDPLVLERPP 126 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = -2 Query: 103 LRRTELRDNAKRTGTXSPGDPLVLERPP 20 + R+ + D R+ + SPGDPLVLERPP Sbjct: 1 MHRSHMEDEI-RSNSCSPGDPLVLERPP 27 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -2 Query: 85 RDNAKRTGTXSPGDPLVLERPP 20 R +R+ + SPGDPLVLERPP Sbjct: 3 RKGDRRSNSCSPGDPLVLERPP 24 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -2 Query: 118 H*QQSLRRTELRDNAKRTGTXSPGDPLVLERPP 20 H +L + + R+ + SPGDPLVLERPP Sbjct: 3 HFTDTLISANIENKCCRSNSCSPGDPLVLERPP 35 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 NA+ + + SPGDPLVLERPP Sbjct: 2 NAQISNSCSPGDPLVLERPP 21 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = -2 Query: 112 QQSLRRTELRDNAKRTGTXSPGDPLVLERPP 20 Q L R ++ A + + SPGDPLVLERPP Sbjct: 127 QNPLGRQKVGHFAPSSNSCSPGDPLVLERPP 157 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = +1 Query: 22 AAALELVDPPGCXFLFVSHYHG 87 AAALELVDPPGC V+ HG Sbjct: 10 AAALELVDPPGCRNSIVTKVHG 31 >SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) Length = 258 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -2 Query: 97 RTELRDNAKRTGTXSPGDPLVLERPP 20 +T LR + + SPGDPLVLERPP Sbjct: 125 QTNLRARIVGSNSCSPGDPLVLERPP 150 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -2 Query: 82 DNAKRTGTXSPGDPLVLERPP 20 D +R+ + SPGDPLVLERPP Sbjct: 4 DAYERSNSCSPGDPLVLERPP 24 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.3 bits (75), Expect = 0.16 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -2 Query: 88 LRDNAKRTGTXSPGDPLVLERPP 20 ++ N ++ + SPGDPLVLERPP Sbjct: 14 VQGNCMKSNSCSPGDPLVLERPP 36 >SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -2 Query: 97 RTELRDNAKRTGTXSPGDPLVLERPP 20 R +L+ + + + SPGDPLVLERPP Sbjct: 10 REKLQGYIRESNSCSPGDPLVLERPP 35 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -2 Query: 76 AKRTGTXSPGDPLVLERPP 20 A R+ + SPGDPLVLERPP Sbjct: 24 ATRSNSCSPGDPLVLERPP 42 >SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) Length = 274 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -2 Query: 91 ELRDNAKRTGTXSPGDPLVLERPP 20 +L + A + + SPGDPLVLERPP Sbjct: 143 DLEEVANSSNSCSPGDPLVLERPP 166 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 N R+ + SPGDPLVLERPP Sbjct: 319 NRVRSNSCSPGDPLVLERPP 338 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 34.3 bits (75), Expect = 0.16 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 82 DNAKRTGTXSPGDPLVLERPP 20 +N + + SPGDPLVLERPP Sbjct: 49 ENGSESNSCSPGDPLVLERPP 69 >SB_9536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 N K + + SPGDPLVLERPP Sbjct: 2 NYKASNSCSPGDPLVLERPP 21 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 +R+ + SPGDPLVLERPP Sbjct: 380 RRSNSCSPGDPLVLERPP 397 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 +R+ + SPGDPLVLERPP Sbjct: 2 RRSNSCSPGDPLVLERPP 19 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = -2 Query: 100 RRTELRDNAKRTGTXSPGDPLVLERPP 20 RR D + + + SPGDPLVLERPP Sbjct: 107 RRFTASDTNEVSNSCSPGDPLVLERPP 133 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -2 Query: 97 RTELRDNAKRTGTXSPGDPLVLERPP 20 R + R ++ + + SPGDPLVLERPP Sbjct: 57 RRKRRKSSTTSNSCSPGDPLVLERPP 82 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 +R+ + SPGDPLVLERPP Sbjct: 5 RRSNSCSPGDPLVLERPP 22 >SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K++ + SPGDPLVLERPP Sbjct: 20 KKSNSCSPGDPLVLERPP 37 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 +R+ + SPGDPLVLERPP Sbjct: 24 RRSNSCSPGDPLVLERPP 41 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = -2 Query: 91 ELRDNAKRTGTXSPGDPLVLERPP 20 +L + +R+ + SPGDPLVLERPP Sbjct: 22 QLIRSLQRSNSCSPGDPLVLERPP 45 >SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K++ + SPGDPLVLERPP Sbjct: 4 KKSNSCSPGDPLVLERPP 21 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 +R+ + SPGDPLVLERPP Sbjct: 58 RRSNSCSPGDPLVLERPP 75 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 +R+ + SPGDPLVLERPP Sbjct: 59 RRSNSCSPGDPLVLERPP 76 >SB_19807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -2 Query: 103 LRRTELRDNAKRTGTXSPGDPLVLERPP 20 +R R +R+G PGDPLVLERPP Sbjct: 15 VRNPRRRLEEERSGYTCPGDPLVLERPP 42 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 82 DNAKRTGTXSPGDPLVLERPP 20 D R+ + SPGDPLVLERPP Sbjct: 50 DKPFRSNSCSPGDPLVLERPP 70 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 +R+ + SPGDPLVLERPP Sbjct: 2 RRSNSCSPGDPLVLERPP 19 >SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 100 RRTELRDNAKRTGTXS--PGDPLVLERPP 20 + T +R+ R G+ S PGDPLVLERPP Sbjct: 52 KTTRMRNRITRGGSNSCSPGDPLVLERPP 80 >SB_719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -2 Query: 97 RTELRDNAKRTGTXSPGDPLVLERPP 20 RT+ K + + SPGDPLVLERPP Sbjct: 160 RTKPLTQEKGSNSCSPGDPLVLERPP 185 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K++ + SPGDPLVLERPP Sbjct: 5 KKSNSCSPGDPLVLERPP 22 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/24 (62%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = -2 Query: 88 LRDNAK-RTGTXSPGDPLVLERPP 20 +R A+ R+ + SPGDPLVLERPP Sbjct: 3 IRGGARYRSNSCSPGDPLVLERPP 26 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 +R+ + SPGDPLVLERPP Sbjct: 11 ERSNSCSPGDPLVLERPP 28 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -2 Query: 88 LRDNAKRTGTXSPGDPLVLERPP 20 ++D + + SPGDPLVLERPP Sbjct: 4 IKDAESTSNSCSPGDPLVLERPP 26 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -2 Query: 85 RDNAKRTGTXSPGDPLVLERPP 20 +D + + + SPGDPLVLERPP Sbjct: 18 KDRLELSNSCSPGDPLVLERPP 39 >SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -2 Query: 67 TGTXSPGDPLVLERPP 20 +G+ SPGDPLVLERPP Sbjct: 170 SGSTSPGDPLVLERPP 185 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.5 bits (73), Expect = 0.28 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 3/25 (12%) Frame = -2 Query: 85 RDNAKRT---GTXSPGDPLVLERPP 20 + NA RT + SPGDPLVLERPP Sbjct: 7 KSNASRTLRSNSCSPGDPLVLERPP 31 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 76 AKRTGTXSPGDPLVLERPP 20 + R+ + SPGDPLVLERPP Sbjct: 3 SNRSNSCSPGDPLVLERPP 21 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +3 Query: 3 RXSTAVGGRSRTSGSPGL 56 R ST+ GGRSRTSGSPGL Sbjct: 98 RSSTSGGGRSRTSGSPGL 115 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 33.5 bits (73), Expect = 0.28 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = -2 Query: 88 LRDNAKRTGTXSPGDPLVLERPP 20 ++ +++ + + SPGDPLVLERPP Sbjct: 46 VKSSSRASNSCSPGDPLVLERPP 68 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -2 Query: 97 RTELRDNAKRTGTXSPGDPLVLERPP 20 +T++ + + SPGDPLVLERPP Sbjct: 31 KTDINPRKPPSNSCSPGDPLVLERPP 56 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -2 Query: 112 QQSLRRTELRDNAKRTGTXSPGDPLVLERPP 20 +QS+ R+ + SPGDPLVLERPP Sbjct: 78 EQSVINQPSMSQHARSNSCSPGDPLVLERPP 108 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 33.5 bits (73), Expect = 0.28 Identities = 20/35 (57%), Positives = 22/35 (62%), Gaps = 4/35 (11%) Frame = -2 Query: 112 QQSLR-RTELRDNA---KRTGTXSPGDPLVLERPP 20 Q LR R LR A R+ + SPGDPLVLERPP Sbjct: 46 QDILRSRAILRSRAIRLSRSNSCSPGDPLVLERPP 80 >SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 N++ + + SPGDPLVLERPP Sbjct: 4 NSQLSNSCSPGDPLVLERPP 23 >SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 82 DNAKRTGTXSPGDPLVLERPP 20 D A + + SPGDPLVLERPP Sbjct: 2 DCASSSNSCSPGDPLVLERPP 22 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -2 Query: 91 ELRDNAKRTGTXSPGDPLVLERPP 20 + R R+ + SPGDPLVLERPP Sbjct: 3 DYRVKRTRSNSCSPGDPLVLERPP 26 >SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) Length = 481 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -2 Query: 91 ELRDNAKRTGTXSPGDPLVLERPP 20 E + A + + SPGDPLVLERPP Sbjct: 350 EKTNEASASNSCSPGDPLVLERPP 373 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 +R+ + SPGDPLVLERPP Sbjct: 6 ERSNSCSPGDPLVLERPP 23 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -2 Query: 88 LRDNAKRTGTXSPGDPLVLERPP 20 + + R+ + SPGDPLVLERPP Sbjct: 49 IENRLMRSNSCSPGDPLVLERPP 71 >SB_12393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -2 Query: 82 DNAKRTGTXSPGDPLVLERPP 20 D+ + + + SPGDPLVLERPP Sbjct: 7 DSLESSNSCSPGDPLVLERPP 27 >SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -2 Query: 109 QSLRRTELRDNAKRTGTXSPGDPLVLERPP 20 +S R R ++ + SPGDPLVLERPP Sbjct: 15 KSWYRAPPRGRRAKSNSCSPGDPLVLERPP 44 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 +R+ + SPGDPLVLERPP Sbjct: 20 ERSNSCSPGDPLVLERPP 37 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 KR SPGDPLVLERPP Sbjct: 11 KRRAWKSPGDPLVLERPP 28 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 3 RSNSCSPGDPLVLERPP 19 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 N+ + + SPGDPLVLERPP Sbjct: 10 NSHTSNSCSPGDPLVLERPP 29 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 21 RSNSCSPGDPLVLERPP 37 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 24 RSNSCSPGDPLVLERPP 40 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 10 RSNSCSPGDPLVLERPP 26 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 16 RSNSCSPGDPLVLERPP 32 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 4 RSNSCSPGDPLVLERPP 20 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 76 AKRTGTXSPGDPLVLERPP 20 A ++ + SPGDPLVLERPP Sbjct: 21 ASQSNSCSPGDPLVLERPP 39 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -2 Query: 85 RDNAKRTGTXSPGDPLVLERPP 20 +++A + + SPGDPLVLERPP Sbjct: 19 KNDALSSNSCSPGDPLVLERPP 40 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 N+ + + SPGDPLVLERPP Sbjct: 11 NSTASNSCSPGDPLVLERPP 30 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 3 RSNSCSPGDPLVLERPP 19 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 3 RSNSCSPGDPLVLERPP 19 >SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 76 AKRTGTXSPGDPLVLERPP 20 +K + + SPGDPLVLERPP Sbjct: 5 SKSSNSCSPGDPLVLERPP 23 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 4 RSNSCSPGDPLVLERPP 20 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 29 RSNSCSPGDPLVLERPP 45 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 66 RSNSCSPGDPLVLERPP 82 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 16 RSNSCSPGDPLVLERPP 32 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 69 RSNSCSPGDPLVLERPP 85 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 558 RSNSCSPGDPLVLERPP 574 >SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 Query: 94 TELRDNAKRTGTXSPGDPLVLERPP 20 T + N + + SPGDPLVLERPP Sbjct: 7 TLISANINSSNSCSPGDPLVLERPP 31 >SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 + K + + SPGDPLVLERPP Sbjct: 11 SGKASNSCSPGDPLVLERPP 30 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 31 RSNSCSPGDPLVLERPP 47 >SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 3 RSNSCSPGDPLVLERPP 19 >SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 3 RSNSCSPGDPLVLERPP 19 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 17 RSNSCSPGDPLVLERPP 33 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.37 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -2 Query: 121 GH*QQSLRRTELRDNAKRTGTXSPGDPLVLERPP 20 GH + ++ + L+ + + SPGDPLVLERPP Sbjct: 16 GH-KIAIENSSLKPTFSISNSCSPGDPLVLERPP 48 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 20 RSNSCSPGDPLVLERPP 36 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 54 RSNSCSPGDPLVLERPP 70 >SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 7 RSNSCSPGDPLVLERPP 23 >SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 82 DNAKRTGTXSPGDPLVLERPP 20 D + + + SPGDPLVLERPP Sbjct: 38 DTTQGSNSCSPGDPLVLERPP 58 >SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 3 RSNSCSPGDPLVLERPP 19 >SB_40640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -2 Query: 100 RRTELRDNAKRTGTXSPGDPLVLERPP 20 RR + ++R +PGDPLVLERPP Sbjct: 75 RRQKAASLSRRDSYENPGDPLVLERPP 101 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 17 RSNSCSPGDPLVLERPP 33 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 45 RSNSCSPGDPLVLERPP 61 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 16 RSNSCSPGDPLVLERPP 32 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 25 RSNSCSPGDPLVLERPP 41 >SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 N + + + SPGDPLVLERPP Sbjct: 22 NVEGSNSCSPGDPLVLERPP 41 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 14 RSNSCSPGDPLVLERPP 30 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.1 bits (72), Expect = 0.37 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -2 Query: 94 TELRDNAKRTGTXSPGDPLVLERPP 20 T L+ +K + + SPGDPLVLERPP Sbjct: 9 TWLKFVSKVSNSCSPGDPLVLERPP 33 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 7 RSNSCSPGDPLVLERPP 23 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 8 RSNSCSPGDPLVLERPP 24 >SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 33.1 bits (72), Expect = 0.37 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 4/62 (6%) Frame = -2 Query: 193 CHRNKHKHKMQSRDEHFLY*LLQ-TGH*QQSLRRTE---LRDNAKRTGTXSPGDPLVLER 26 C+RN+ + ++ + L++ G+ ++ +T L K + + SPGDPLVLER Sbjct: 4 CYRNRATNSIKKAKATYNRKLIERNGNDHRTFWKTLKKILPGEKKTSNSCSPGDPLVLER 63 Query: 25 PP 20 PP Sbjct: 64 PP 65 >SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) Length = 134 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 76 AKRTGTXSPGDPLVLERPP 20 +K + + SPGDPLVLERPP Sbjct: 8 SKTSNSCSPGDPLVLERPP 26 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 12 RSNSCSPGDPLVLERPP 28 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 214 RSNSCSPGDPLVLERPP 230 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 33.1 bits (72), Expect = 0.37 Identities = 21/69 (30%), Positives = 35/69 (50%) Frame = -2 Query: 226 AVLPHSSPLANCHRNKHKHKMQSRDEHFLY*LLQTGH*QQSLRRTELRDNAKRTGTXSPG 47 A LPH+ + H + + +++ L L + G + R + ++ + + SPG Sbjct: 467 ATLPHAQIVKLA---SHANIIMCQEQSILK-LWRLGESGSASARESVPSSSTPSNSCSPG 522 Query: 46 DPLVLERPP 20 DPLVLERPP Sbjct: 523 DPLVLERPP 531 Score = 29.1 bits (62), Expect = 6.0 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 52 PGDPLVLERPP 20 PGDPLVLERPP Sbjct: 664 PGDPLVLERPP 674 >SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 1 RSNSCSPGDPLVLERPP 17 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 5 RSNSCSPGDPLVLERPP 21 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 5 RSNSCSPGDPLVLERPP 21 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 R+ + SPGDPLVLERPP Sbjct: 35 RSNSCSPGDPLVLERPP 51 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.7 bits (71), Expect = 0.49 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -2 Query: 100 RRTELRDNAKRTGTXSPGDPLVLERPP 20 R E + + + SPGDPLVLERPP Sbjct: 7 RENEAKKAGGGSNSCSPGDPLVLERPP 33 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 9 KTSNSCSPGDPLVLERPP 26 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -2 Query: 85 RDNAKRTGTXSPGDPLVLERPP 20 R + + + + SPGDPLVLERPP Sbjct: 18 RRSKRASNSCSPGDPLVLERPP 39 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 56 QPGGSTSSRAAAHRGGA 6 QPGGSTSSRAAA GGA Sbjct: 37 QPGGSTSSRAAATAGGA 53 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 32 KTSNSCSPGDPLVLERPP 49 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.7 bits (71), Expect = 0.49 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 Query: 94 TELRDNAKRTGTXSPGDPLVLERPP 20 T+ A + + SPGDPLVLERPP Sbjct: 8 TDALPTALTSNSCSPGDPLVLERPP 32 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 15 KTSNSCSPGDPLVLERPP 32 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 240 KTSNSCSPGDPLVLERPP 257 >SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 4 KSSNSCSPGDPLVLERPP 21 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 32.7 bits (71), Expect = 0.49 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 103 LRRTELRDNAKRTGTXSPGDPLVLERPP 20 L + E+ + + SPGDPLVLERPP Sbjct: 468 LLQGEIASGQTTSNSCSPGDPLVLERPP 495 >SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) Length = 214 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -2 Query: 91 ELRDNAKRTGTXSPGDPLVLERPP 20 E++D K + + SPGDPLVLERPP Sbjct: 182 EVQDLCK-SNSCSPGDPLVLERPP 204 >SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 82 DNAKRTGTXSPGDPLVLERPP 20 +N + + SPGDPLVLERPP Sbjct: 2 NNLTASNSCSPGDPLVLERPP 22 >SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 26 KTSNSCSPGDPLVLERPP 43 >SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 2 KTSNSCSPGDPLVLERPP 19 >SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 32.7 bits (71), Expect = 0.49 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 Query: 94 TELRDNAKRTGTXSPGDPLVLERPP 20 T + N + + SPGDPLVLERPP Sbjct: 7 TLISANIVESNSCSPGDPLVLERPP 31 >SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) Length = 159 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 34 KTSNSCSPGDPLVLERPP 51 >SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.7 bits (71), Expect = 0.49 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -2 Query: 91 ELRDNAKRTGTXSPGDPLVLERPP 20 EL + + + SPGDPLVLERPP Sbjct: 12 ELGEYLTASNSCSPGDPLVLERPP 35 >SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.7 bits (71), Expect = 0.49 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 Query: 94 TELRDNAKRTGTXSPGDPLVLERPP 20 +EL + + SPGDPLVLERPP Sbjct: 6 SELEKRQVLSNSCSPGDPLVLERPP 30 >SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.7 bits (71), Expect = 0.49 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 +++ + SPGDPLVLERPP Sbjct: 2 RKSNSCSPGDPLVLERPP 19 >SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 76 AKRTGTXSPGDPLVLERPP 20 +K + + SPGDPLVLERPP Sbjct: 17 SKPSNSCSPGDPLVLERPP 35 >SB_31452| Best HMM Match : Telo_bind (HMM E-Value=3.2) Length = 200 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -2 Query: 88 LRDNAKRTGTXSPGDPLVLERPP 20 +RD K G PGDPLVLERPP Sbjct: 72 IRDTCKY-GVTRPGDPLVLERPP 93 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 32.7 bits (71), Expect = 0.49 Identities = 17/33 (51%), Positives = 25/33 (75%), Gaps = 2/33 (6%) Frame = -2 Query: 112 QQSLR-RTELRDNAK-RTGTXSPGDPLVLERPP 20 +QS+R ++ +R+ A + + SPGDPLVLERPP Sbjct: 5 RQSVRAQSNVREAAPLASNSCSPGDPLVLERPP 37 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 85 RDNAKRTGTXSPGDPLVLERPP 20 R + + + SPGDPLVLERPP Sbjct: 19 RQHVAASNSCSPGDPLVLERPP 40 >SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 38 KASNSCSPGDPLVLERPP 55 >SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -2 Query: 100 RRTELRDNAKRTGTXSPGDPLVLERPP 20 +R + + ++ + SPGDPLVLERPP Sbjct: 8 QREKTSKHKAKSNSCSPGDPLVLERPP 34 >SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) Length = 138 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 13 KTSNSCSPGDPLVLERPP 30 >SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 13 KTSNSCSPGDPLVLERPP 30 >SB_11166| Best HMM Match : CARD (HMM E-Value=0.001) Length = 720 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 KR +PGDPLVLERPP Sbjct: 595 KRRSNINPGDPLVLERPP 612 >SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 82 DNAKRTGTXSPGDPLVLERPP 20 +N + + SPGDPLVLERPP Sbjct: 29 ENKALSNSCSPGDPLVLERPP 49 >SB_5594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -2 Query: 85 RDNAKRTGTXSPGDPLVLERPP 20 R+ + + + SPGDPLVLERPP Sbjct: 6 REKSGGSNSCSPGDPLVLERPP 27 >SB_1318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 5 KASNSCSPGDPLVLERPP 22 >SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 32.7 bits (71), Expect = 0.49 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 19 KSSNSCSPGDPLVLERPP 36 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 +++ + SPGDPLVLERPP Sbjct: 10 EKSNSCSPGDPLVLERPP 27 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 61 KLSNSCSPGDPLVLERPP 78 >SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 6 KLSNSCSPGDPLVLERPP 23 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 +++ + SPGDPLVLERPP Sbjct: 70 QKSNSCSPGDPLVLERPP 87 >SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 32.3 bits (70), Expect = 0.64 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = -2 Query: 151 EHFLY*LLQTGH*QQSLRRTELRDNAKR---TGTXSPGDPLVLERPP 20 +HF L+ Q + L+ N ++ + + SPGDPLVLERPP Sbjct: 2 KHFTDTLISANIVQLAADNAYLQGNGQKKNASNSCSPGDPLVLERPP 48 >SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 N + + SPGDPLVLERPP Sbjct: 4 NLNGSNSCSPGDPLVLERPP 23 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 +++ + SPGDPLVLERPP Sbjct: 23 RQSNSCSPGDPLVLERPP 40 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 32.3 bits (70), Expect = 0.64 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = -2 Query: 112 QQSLRRTELRDNAKRTGTXSPGDPLVLERPP 20 Q S R D ++ + SPGDPLVLERPP Sbjct: 173 QTSSYRPCYTDLVIQSNSCSPGDPLVLERPP 203 >SB_53920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 61 TXSPGDPLVLERPP 20 T SPGDPLVLERPP Sbjct: 61 TKSPGDPLVLERPP 74 >SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 20 KGSNSCSPGDPLVLERPP 37 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 N + + SPGDPLVLERPP Sbjct: 4 NTLASNSCSPGDPLVLERPP 23 >SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 4 KGSNSCSPGDPLVLERPP 21 >SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 76 AKRTGTXSPGDPLVLERPP 20 A+ + + SPGDPLVLERPP Sbjct: 42 AEPSNSCSPGDPLVLERPP 60 >SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 3 KGSNSCSPGDPLVLERPP 20 >SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 32.3 bits (70), Expect = 0.64 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 Query: 94 TELRDNAKRTGTXSPGDPLVLERPP 20 T + N + + SPGDPLVLERPP Sbjct: 7 TLISANITGSNSCSPGDPLVLERPP 31 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 +++ + SPGDPLVLERPP Sbjct: 13 QKSNSCSPGDPLVLERPP 30 >SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -2 Query: 85 RDNAKRTGTXSPGDPLVLERPP 20 R++ + + SPGDPLVLERPP Sbjct: 8 RESYALSNSCSPGDPLVLERPP 29 >SB_35386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 32.3 bits (70), Expect = 0.64 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 82 DNAKRTGTXSPGDPLVLERPP 20 D A SPGDPLVLERPP Sbjct: 18 DMALEASDYSPGDPLVLERPP 38 >SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 8 KPSNSCSPGDPLVLERPP 25 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -2 Query: 82 DNAKRTGTXSPGDPLVLERPP 20 + A+ + + SPGDPLVLERPP Sbjct: 2 NKAEVSNSCSPGDPLVLERPP 22 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 32.3 bits (70), Expect = 0.64 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 Query: 94 TELRDNAKRTGTXSPGDPLVLERPP 20 T + N + + SPGDPLVLERPP Sbjct: 7 TLISANISVSNSCSPGDPLVLERPP 31 >SB_32058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K+ SPGDPLVLERPP Sbjct: 45 KKEAERSPGDPLVLERPP 62 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -2 Query: 82 DNAKRTGTXSPGDPLVLERPP 20 ++ K + + SPGDPLVLERPP Sbjct: 14 NHLKVSNSCSPGDPLVLERPP 34 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -2 Query: 76 AKRTGTXSPGDPLVLERPP 20 A + + SPGDPLVLERPP Sbjct: 70 ATESNSCSPGDPLVLERPP 88 >SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 27 KGSNSCSPGDPLVLERPP 44 >SB_29960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 1 KLSNSCSPGDPLVLERPP 18 >SB_27752| Best HMM Match : ASC (HMM E-Value=3.7e-07) Length = 505 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 64 GTXSPGDPLVLERPP 20 GT PGDPLVLERPP Sbjct: 23 GTAYPGDPLVLERPP 37 >SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 N + + SPGDPLVLERPP Sbjct: 4 NTTPSNSCSPGDPLVLERPP 23 >SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 44 KPSNSCSPGDPLVLERPP 61 >SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 42 KGSNSCSPGDPLVLERPP 59 >SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.64 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 3/30 (10%) Frame = -2 Query: 100 RRTELRDNAKRTGTX---SPGDPLVLERPP 20 R+T+ + ++R T SPGDPLVLERPP Sbjct: 2 RQTDNLEGSRRLQTSNSCSPGDPLVLERPP 31 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.64 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 88 LRDNAKRTGTXSPGDPLVLERPP 20 LR + + SPGDPLVLERPP Sbjct: 15 LRGICAASNSCSPGDPLVLERPP 37 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 76 AKRTGTXSPGDPLVLERPP 20 +K + + SPGDPLVLERPP Sbjct: 4 SKISNSCSPGDPLVLERPP 22 >SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -2 Query: 85 RDNAKRTGTXSPGDPLVLERPP 20 R + + + + SPGDPLVLERPP Sbjct: 24 RCSCQSSNSCSPGDPLVLERPP 45 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 13 KPSNSCSPGDPLVLERPP 30 >SB_1937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 64 GTXSPGDPLVLERPP 20 G SPGDPLVLERPP Sbjct: 46 GPFSPGDPLVLERPP 60 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 100 KISNSCSPGDPLVLERPP 117 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 31.9 bits (69), Expect = 0.85 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 56 QPGGSTSSRAAAHRGGA 6 QPGGSTSSRAAA GGA Sbjct: 24 QPGGSTSSRAAATVGGA 40 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -2 Query: 85 RDNAKRTGTXSPGDPLVLERPP 20 R ++ + + SPGDPLVLERPP Sbjct: 10 RSASQVSNSCSPGDPLVLERPP 31 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 85 RDNAKRTGTXSPGDPLVLERPP 20 R + + + SPGDPLVLERPP Sbjct: 15 RGSQTASNSCSPGDPLVLERPP 36 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -2 Query: 76 AKRTGTXSPGDPLVLERPP 20 A + + SPGDPLVLERPP Sbjct: 33 ASLSNSCSPGDPLVLERPP 51 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 85 RDNAKRTGTXSPGDPLVLERPP 20 R+ + + SPGDPLVLERPP Sbjct: 41 REGPGGSNSCSPGDPLVLERPP 62 >SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) Length = 1312 Score = 31.9 bits (69), Expect = 0.85 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -2 Query: 112 QQSLRRTELRDNAKRTGTXSPGDPLVLERPP 20 + L R R++ + G PGDPLVLERPP Sbjct: 581 ENELNRLHSRESGRSRG---PGDPLVLERPP 608 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K T + PGDPLVLERPP Sbjct: 51 KTTASEFPGDPLVLERPP 68 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.9 bits (69), Expect = 0.85 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 + + + SPGDPLVLERPP Sbjct: 21 RESNSCSPGDPLVLERPP 38 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 31.9 bits (69), Expect = 0.85 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 4/27 (14%) Frame = -2 Query: 88 LRDNAKR----TGTXSPGDPLVLERPP 20 +R AKR + + SPGDPLVLERPP Sbjct: 73 IRRGAKRQQMASNSCSPGDPLVLERPP 99 >SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 31.9 bits (69), Expect = 0.85 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K T SPGDPLVLERPP Sbjct: 136 KLTYRNSPGDPLVLERPP 153 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -2 Query: 76 AKRTGTXSPGDPLVLERPP 20 A + + SPGDPLVLERPP Sbjct: 19 APTSNSCSPGDPLVLERPP 37 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 33 KVSNSCSPGDPLVLERPP 50 >SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 31.9 bits (69), Expect = 0.85 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 + + + SPGDPLVLERPP Sbjct: 76 RESNSCSPGDPLVLERPP 93 >SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.9 bits (69), Expect = 0.85 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 +++++ SPGDPLVLERPP Sbjct: 21 SSRKSPPRSPGDPLVLERPP 40 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 31.9 bits (69), Expect = 0.85 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -2 Query: 97 RTELRDNAKRTGTXSPGDPLVLERPP 20 R E + + + SPGDPLVLERPP Sbjct: 70 RDECKGILLTSNSCSPGDPLVLERPP 95 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 2 KVSNSCSPGDPLVLERPP 19 >SB_4676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 31.9 bits (69), Expect = 0.85 Identities = 21/50 (42%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -3 Query: 183 TNTNTKCNHATNTSFINYYKLGTDNNRCVALNSVIMRNEQE--PAARGIH 40 TNTNT N TN+ N T NN N+ N PAARGIH Sbjct: 22 TNTNTNSNSNTNSKNSNSNTTTTTNNNNNNNNNNNNNNNNNRIPAARGIH 71 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 N + + SPGDPLVLERPP Sbjct: 3 NLLASNSCSPGDPLVLERPP 22 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 151 KISNSCSPGDPLVLERPP 168 >SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -2 Query: 76 AKRTGTXSPGDPLVLERPP 20 A + + SPGDPLVLERPP Sbjct: 2 AATSNSCSPGDPLVLERPP 20 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.9 bits (69), Expect = 0.85 Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = -2 Query: 118 H*QQSLRRTELRD-NAKRTGTXSPGDPLVLERPP 20 H ++L + + D +A + + SPGDPLVLERPP Sbjct: 8 HASRNLIESPICDCHAHVSNSCSPGDPLVLERPP 41 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 31.9 bits (69), Expect = 0.85 Identities = 18/33 (54%), Positives = 21/33 (63%), Gaps = 3/33 (9%) Frame = -2 Query: 109 QSLRR---TELRDNAKRTGTXSPGDPLVLERPP 20 QS RR T +A + + SPGDPLVLERPP Sbjct: 2406 QSARRGSDTGGSSSAIASNSCSPGDPLVLERPP 2438 >SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) Length = 263 Score = 31.9 bits (69), Expect = 0.85 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -2 Query: 106 SLRRTELRDNAKRTGTXSPGDPLVLERPP 20 +L + L + + + SPGDPLVLERPP Sbjct: 127 TLHKYRLMFHLPGSNSCSPGDPLVLERPP 155 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.9 bits (69), Expect = 0.85 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 91 ELRDNAKRTGTXSPGDPLVLERPP 20 E R + + SPGDPLVLERPP Sbjct: 19 ETRHLQAASNSCSPGDPLVLERPP 42 >SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.9 bits (69), Expect = 0.85 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 ++ + SPGDPLVLERPP Sbjct: 3 KSNSCSPGDPLVLERPP 19 >SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 0.85 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 Query: 94 TELRDNAKRTGTXSPGDPLVLERPP 20 T + N + + SPGDPLVLERPP Sbjct: 7 TLISANIISSNSCSPGDPLVLERPP 31 >SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.9 bits (69), Expect = 0.85 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 ++ + SPGDPLVLERPP Sbjct: 11 KSNSCSPGDPLVLERPP 27 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.9 bits (69), Expect = 0.85 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 + + + SPGDPLVLERPP Sbjct: 17 RESNSCSPGDPLVLERPP 34 >SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.9 bits (69), Expect = 0.85 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 ++ + SPGDPLVLERPP Sbjct: 4 KSNSCSPGDPLVLERPP 20 >SB_23941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.9 bits (69), Expect = 0.85 Identities = 14/22 (63%), Positives = 17/22 (77%), Gaps = 1/22 (4%) Frame = -2 Query: 82 DNAKRTG-TXSPGDPLVLERPP 20 +N + T + SPGDPLVLERPP Sbjct: 2 NNVRHTSNSCSPGDPLVLERPP 23 >SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 N + + SPGDPLVLERPP Sbjct: 107 NGFTSNSCSPGDPLVLERPP 126 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -2 Query: 73 KRTGTXSPGDPLVLERPP 20 K + + SPGDPLVLERPP Sbjct: 67 KISNSCSPGDPLVLERPP 84 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 31.9 bits (69), Expect = 0.85 Identities = 16/27 (59%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Frame = -2 Query: 94 TELRDNAKRT--GTXSPGDPLVLERPP 20 T R + K T + SPGDPLVLERPP Sbjct: 35 TSFRTSNKPTISNSCSPGDPLVLERPP 61 >SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 146 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 79 NAKRTGTXSPGDPLVLERPP 20 N + + SPGDPLVLERPP Sbjct: 19 NMAGSNSCSPGDPLVLERPP 38 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -2 Query: 88 LRDNAKRTGTXSPGDPLVLERPP 20 +RD + + SPGDPLVLERPP Sbjct: 1 MRDGGA-SNSCSPGDPLVLERPP 22 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 ++ + SPGDPLVLERPP Sbjct: 6 QSNSCSPGDPLVLERPP 22 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 67 TGTXSPGDPLVLERPP 20 T SPGDPLVLERPP Sbjct: 631 TKATSPGDPLVLERPP 646 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 118 H*QQSLRRTELRDNAKRTGTXSPGDPLVLERPP 20 H +L ++ + + SPGDPLVLERPP Sbjct: 3 HFTDTLISANIKGRHCASNSCSPGDPLVLERPP 35 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -2 Query: 76 AKRTGTXSPGDPLVLERPP 20 ++ + + SPGDPLVLERPP Sbjct: 38 SRGSNSCSPGDPLVLERPP 56 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -2 Query: 76 AKRTGTXSPGDPLVLERPP 20 A + + SPGDPLVLERPP Sbjct: 480 AGASNSCSPGDPLVLERPP 498 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 88 LRDNAKRTGTXSPGDPLVLERPP 20 LR + + SPGDPLVLERPP Sbjct: 7 LRITKVLSNSCSPGDPLVLERPP 29 >SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 ++ + SPGDPLVLERPP Sbjct: 2 QSNSCSPGDPLVLERPP 18 >SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 109 QSLRRTELRDNAKRTGTXSPGDPLVLERPP 20 +S R R + + SPG+PLVLERPP Sbjct: 4 KSASRVHYRKIVSISNSCSPGEPLVLERPP 33 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 ++ + SPGDPLVLERPP Sbjct: 62 QSNSCSPGDPLVLERPP 78 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 Query: 94 TELRDNAKRTGTXSPGDPLVLERPP 20 T + N + + SPGDPLVLERPP Sbjct: 7 TLISANIFLSNSCSPGDPLVLERPP 31 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 88 LRDNAKRTGTXSPGDPLVLERPP 20 LR + + SPGDPLVLERPP Sbjct: 84 LRPCIVTSNSCSPGDPLVLERPP 106 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -2 Query: 76 AKRTGTXSPGDPLVLERPP 20 A + + SPGDPLVLERPP Sbjct: 2 ANISNSCSPGDPLVLERPP 20 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 Query: 94 TELRDNAKRTGTXSPGDPLVLERPP 20 T + N + + SPGDPLVLERPP Sbjct: 7 TLISANIVISNSCSPGDPLVLERPP 31 >SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 70 RTGTXSPGDPLVLERPP 20 ++ + SPGDPLVLERPP Sbjct: 29 QSNSCSPGDPLVLERPP 45 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,449,900 Number of Sequences: 59808 Number of extensions: 325645 Number of successful extensions: 3178 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3092 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3173 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3023635215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -