BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0793 (981 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8756| Best HMM Match : DUF1168 (HMM E-Value=1) 76 4e-14 SB_9948| Best HMM Match : Autophagy_N (HMM E-Value=4.9) 57 3e-08 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 39 0.005 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_24089| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_30377| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 37 0.022 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 37 0.022 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 37 0.029 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 36 0.038 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 36 0.050 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 36 0.066 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 36 0.066 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 36 0.066 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 35 0.088 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 35 0.088 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 35 0.12 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 35 0.12 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 35 0.12 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 35 0.12 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 34 0.15 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 34 0.15 SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 34 0.15 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) 34 0.15 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 34 0.15 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 34 0.15 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 34 0.20 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 34 0.20 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 34 0.20 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 34 0.20 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 34 0.20 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_5594| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 33 0.27 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 33 0.27 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 33 0.27 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 33 0.27 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 33 0.27 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 33 0.27 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 33 0.27 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 33 0.27 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 33 0.27 SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 33 0.27 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 33 0.27 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_12301| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 33 0.27 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 33 0.27 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 33 0.35 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 33 0.35 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 33 0.35 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 33 0.35 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 33 0.35 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 33 0.35 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 33 0.35 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 33 0.35 SB_19937| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 33 0.35 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 33 0.35 SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) 33 0.35 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 33 0.35 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.41 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 33 0.47 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 33 0.47 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 33 0.47 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 33 0.47 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 33 0.47 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 33 0.47 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 33 0.47 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 33 0.47 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 33 0.47 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_39086| Best HMM Match : Herpes_capsid (HMM E-Value=2.7) 33 0.47 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 33 0.47 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 33 0.47 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 33 0.47 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 33 0.47 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 33 0.47 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 33 0.47 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 33 0.47 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 33 0.47 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 33 0.47 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 33 0.47 >SB_8756| Best HMM Match : DUF1168 (HMM E-Value=1) Length = 346 Score = 76.2 bits (179), Expect = 4e-14 Identities = 41/94 (43%), Positives = 60/94 (63%), Gaps = 8/94 (8%) Frame = +1 Query: 247 FESQSVTAESSLQEFLSTAELAQREFTAEKLNLKYVK-----SVPSEVAIVT---SQPDF 402 F S+T +S L EFL++A+LA EFTAEKLN+ +V V SE + +Q D Sbjct: 37 FTISSITEQSDLDEFLASAQLAGTEFTAEKLNVTFVTPQYDTGVLSEEKVTNIKQAQEDN 96 Query: 403 DEPLTVPRRPQWNPGVTAEEQLNRERETFLDWRR 504 + L +PRRP+WN ++AEE +ER++F++WRR Sbjct: 97 RQLLRIPRRPEWNKSMSAEELDLKERDSFVEWRR 130 Score = 59.3 bits (137), Expect = 5e-09 Identities = 29/73 (39%), Positives = 43/73 (58%), Gaps = 2/73 (2%) Frame = +3 Query: 582 WRTLEKSDIVLILLDARNPLLFRCVDLEKYAKEQK--CKSILLLNKADLTSEYERKCWG* 755 WR D+++ ++DARNP LFRC DL Y KE ++LL+NKAD + +R W Sbjct: 128 WRRQLAIDVIVQIVDARNPELFRCEDLAVYVKEVNPLKANLLLINKADYLTPSQRLKWAE 187 Query: 756 IFHKENIRIVFFS 794 + NI++ F+S Sbjct: 188 YYKSRNIQVAFWS 200 >SB_9948| Best HMM Match : Autophagy_N (HMM E-Value=4.9) Length = 166 Score = 56.8 bits (131), Expect = 3e-08 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 2/72 (2%) Frame = +3 Query: 603 DIVLILLDARNPLLFRCVDLEKYAKEQK--CKSILLLNKADLTSEYERKCWG*IFHKENI 776 D+++ ++DARNP LFRC DL Y KE ++LL+NKAD + +R W + NI Sbjct: 2 DVIVQIVDARNPELFRCEDLAVYVKEVNPLKANLLLINKADYLTPSQRLKWAEYYKSRNI 61 Query: 777 RIVFFSGRQNYE 812 ++ F+S + E Sbjct: 62 QVAFWSALADNE 73 >SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/46 (58%), Positives = 30/46 (65%), Gaps = 5/46 (10%) Frame = -3 Query: 142 SPKRLF-----ILLAHYLNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 SP+R F ILL +N+ KT DTTS NSCSPGDPLVLER Sbjct: 25 SPERNFDLCTTILLILSINIERKT-EDTTS---NSCSPGDPLVLER 66 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -3 Query: 91 KTGRDTTSLVPNSCSPGDPLVLER 20 KT D + + NSCSPGDPLVLER Sbjct: 43 KTAGDVIAFISNSCSPGDPLVLER 66 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -3 Query: 94 YKTGRDTTSLVPNSCSPGDPLVLER 20 Y+T T+L NSCSPGDPLVLER Sbjct: 6 YETDALPTALTSNSCSPGDPLVLER 30 >SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -3 Query: 106 LNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 ++ H RDT + NSCSPGDPLVLER Sbjct: 9 MDRHRDIDRDTDRHLSNSCSPGDPLVLER 37 >SB_24089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 693 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 2/73 (2%) Frame = +3 Query: 591 LEKSDIVLILLDARNPLLFRCVDLEK--YAKEQKCKSILLLNKADLTSEYERKCWG*IFH 764 +E +D++L +LDAR+P+ RC +E+ A K +L+LNK DL + + W Sbjct: 335 VEAADVILEVLDARDPIGCRCPQVEQAVIAAGATKKLVLILNKIDLVPKDIAEKWLKYLR 394 Query: 765 KENIRIVFFSGRQ 803 E ++F + Q Sbjct: 395 NEFPAVIFKASTQ 407 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = -3 Query: 109 YLNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 YL L Y T V NSCSPGDPLVLER Sbjct: 15 YLGLLYPTEDYKVYPVSNSCSPGDPLVLER 44 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = -3 Query: 88 TGRDTTSLVPNSCSPGDPLVLER 20 TG ++++ NSCSPGDPLVLER Sbjct: 2414 TGGSSSAIASNSCSPGDPLVLER 2436 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -3 Query: 112 HYLNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 +Y+ Y +T ++ NSCSPGDPLVLER Sbjct: 89 YYMTSSYGVSGWSTFILSNSCSPGDPLVLER 119 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.1 bits (82), Expect = 0.022 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -3 Query: 91 KTGRDTTSLVPNSCSPGDPLVLER 20 KTG TTS NSCSPGDPLVLER Sbjct: 3 KTGITTTS---NSCSPGDPLVLER 23 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -3 Query: 91 KTGRDTTSLVPNSCSPGDPLVLER 20 K R ++V NSCSPGDPLVLER Sbjct: 69 KHHRGVNTIVSNSCSPGDPLVLER 92 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -3 Query: 82 RDTTSLVPNSCSPGDPLVLER 20 R SL+ NSCSPGDPLVLER Sbjct: 28 RYRVSLISNSCSPGDPLVLER 48 >SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -3 Query: 88 TGRDTTSLVPNSCSPGDPLVLER 20 T R++T NSCSPGDPLVLER Sbjct: 17 TTRESTPFGSNSCSPGDPLVLER 39 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 37.1 bits (82), Expect = 0.022 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = +1 Query: 22 ALELVDPPGCRNSARGKLYLSLF 90 ALELVDPPGCRNS R +++F Sbjct: 12 ALELVDPPGCRNSIRSTTTITIF 34 >SB_30377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 37.1 bits (82), Expect = 0.022 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 2/80 (2%) Frame = +3 Query: 573 KQLWRTLEKSDIVLILLDARNPLLFRCVDLEKYAKEQKCKS--ILLLNKADLTSEYERKC 746 K++W L K +LDAR+PL R +E + K++K I +LNK DL + + Sbjct: 71 KRIWNELYK------VLDARDPLGTRSKHIETFIKKEKSHKHLIFILNKCDLVPTWVTQQ 124 Query: 747 WG*IFHKENIRIVFFSGRQN 806 W + +E+ + F + N Sbjct: 125 WVSVLSEEHPTLAFHASVTN 144 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = -3 Query: 103 NLHYKTGRDTTSLVPNSCSPGDPLVLER 20 +L Y G + + NSCSPGDPLVLER Sbjct: 2 HLTYTAGTNLVTASSNSCSPGDPLVLER 29 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 79 DTTSLVPNSCSPGDPLVLER 20 D SL NSCSPGDPLVLER Sbjct: 11 DLKSLTSNSCSPGDPLVLER 30 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 SL+ NSCSPGDPLVLER Sbjct: 32 SLISNSCSPGDPLVLER 48 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 36.7 bits (81), Expect = 0.029 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 TSL NSCSPGDPLVLER Sbjct: 2 TSLSSNSCSPGDPLVLER 19 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 SL+ NSCSPGDPLVLER Sbjct: 32 SLISNSCSPGDPLVLER 48 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 36.7 bits (81), Expect = 0.029 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -3 Query: 91 KTGRDTTSLVPNSCSPGDPLVLER 20 + G T L NSCSPGDPLVLER Sbjct: 57 RVGHHTPILPSNSCSPGDPLVLER 80 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 SL+ NSCSPGDPLVLER Sbjct: 32 SLISNSCSPGDPLVLER 48 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 SL+ NSCSPGDPLVLER Sbjct: 32 SLISNSCSPGDPLVLER 48 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 SL+ NSCSPGDPLVLER Sbjct: 32 SLISNSCSPGDPLVLER 48 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 SL+ NSCSPGDPLVLER Sbjct: 32 SLISNSCSPGDPLVLER 48 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 SL+ NSCSPGDPLVLER Sbjct: 33 SLISNSCSPGDPLVLER 49 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -3 Query: 76 TTSLVPNSCSPGDPLVLER 20 +TS + NSCSPGDPLVLER Sbjct: 2 STSKISNSCSPGDPLVLER 20 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 SL+ NSCSPGDPLVLER Sbjct: 32 SLISNSCSPGDPLVLER 48 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 SL+ NSCSPGDPLVLER Sbjct: 30 SLISNSCSPGDPLVLER 46 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 36.3 bits (80), Expect = 0.038 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = -3 Query: 103 NLHYKTGRDTTSLVPNSCSPGDPLVLER 20 N+ + LV NSCSPGDPLVLER Sbjct: 12 NIPLRNPNTRAHLVSNSCSPGDPLVLER 39 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 36.3 bits (80), Expect = 0.038 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 S+V NSCSPGDPLVLER Sbjct: 346 SIVSNSCSPGDPLVLER 362 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 36.3 bits (80), Expect = 0.038 Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 118 LAHYLNLHYKTGRDTTSLVP-NSCSPGDPLVLER 20 + + + L + R T +P NSCSPGDPLVLER Sbjct: 1 MQYSVTLMCRASRKTRKKIPSNSCSPGDPLVLER 34 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.3 bits (80), Expect = 0.038 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 79 DTTSLVPNSCSPGDPLVLER 20 + TS NSCSPGDPLVLER Sbjct: 9 NNTSFTSNSCSPGDPLVLER 28 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 36.3 bits (80), Expect = 0.038 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = -3 Query: 109 YLNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 +L H+ +L NSCSPGDPLVLER Sbjct: 9 HLGRHFTGHAKNDALSSNSCSPGDPLVLER 38 >SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 36.3 bits (80), Expect = 0.038 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -2 Query: 80 RYNFPRAEFLQPGGSTSSRA 21 ++NF + EFLQPGGSTSSRA Sbjct: 24 KFNFCKIEFLQPGGSTSSRA 43 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 36.3 bits (80), Expect = 0.038 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 79 DTTSLVPNSCSPGDPLVLER 20 D T V NSCSPGDPLVLER Sbjct: 179 DWTRRVSNSCSPGDPLVLER 198 >SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.3 bits (80), Expect = 0.038 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = -3 Query: 100 LHYKTGRDTTSLVPNSCSPGDPLVLER 20 L YK D TS NSCSPGDPLVLER Sbjct: 3 LSYKQTDDRTS---NSCSPGDPLVLER 26 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 36.3 bits (80), Expect = 0.038 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -3 Query: 82 RDTTSLVPNSCSPGDPLVLER 20 R+ L NSCSPGDPLVLER Sbjct: 15 REAAPLASNSCSPGDPLVLER 35 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.3 bits (80), Expect = 0.038 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -3 Query: 97 HYKTGRDTTSLVPNSCSPGDPLVLER 20 H+ + ++V NSCSPGDPLVLER Sbjct: 3 HFTDTLISANIVSNSCSPGDPLVLER 28 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 36.3 bits (80), Expect = 0.038 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = -3 Query: 118 LAHYLNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 + +L +Y + ++ L NSCSPGDPLVLER Sbjct: 196 IPRFLLRYYGSAQNGKHLRSNSCSPGDPLVLER 228 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.3 bits (80), Expect = 0.038 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +1 Query: 22 ALELVDPPGCRNSARGK 72 ALELVDPPGCRNS GK Sbjct: 88 ALELVDPPGCRNSIAGK 104 >SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 36.3 bits (80), Expect = 0.038 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -3 Query: 100 LHYKTGRDTTSLVPNSCSPGDPLVLER 20 +H+ +T + NSCSPGDPLVLER Sbjct: 57 VHHIISAETMVIESNSCSPGDPLVLER 83 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 3/25 (12%) Frame = -3 Query: 85 GRDTTSLVP---NSCSPGDPLVLER 20 G + SLVP NSCSPGDPLVLER Sbjct: 16 GTNGASLVPRPSNSCSPGDPLVLER 40 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/21 (66%), Positives = 19/21 (90%) Frame = -3 Query: 82 RDTTSLVPNSCSPGDPLVLER 20 R+++++ NSCSPGDPLVLER Sbjct: 16 RNSSNISSNSCSPGDPLVLER 36 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -3 Query: 103 NLHYKTGRDTTSLVPNSCSPGDPLVLER 20 N+ Y + NSCSPGDPLVLER Sbjct: 12 NISYPKRNSNSHTASNSCSPGDPLVLER 39 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 85 GRDTTSLVPNSCSPGDPLVLER 20 G D NSCSPGDPLVLER Sbjct: 1186 GNDLKPFASNSCSPGDPLVLER 1207 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 97 HYKTGRDTTSLVPNSCSPGDPLVLER 20 H+ + +++ NSCSPGDPLVLER Sbjct: 3 HFTDTLISANIISNSCSPGDPLVLER 28 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 35.9 bits (79), Expect = 0.050 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = -3 Query: 145 GSPKRLFILLAHYLNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 G L+ + + K T+ NSCSPGDPLVLER Sbjct: 45 GKKPPLYTQIKSFFLARVKAANFVTATESNSCSPGDPLVLER 86 >SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 35.9 bits (79), Expect = 0.050 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 89 NRERYNFPRAEFLQPGGSTSSRA 21 N E + +P EFLQPGGSTSSRA Sbjct: 12 NIESHPYPDIEFLQPGGSTSSRA 34 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 76 TTSLVPNSCSPGDPLVLER 20 T +V NSCSPGDPLVLER Sbjct: 82 TQRIVSNSCSPGDPLVLER 100 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 35.9 bits (79), Expect = 0.050 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -3 Query: 124 ILLAHYLNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 +LL + ++ T + + NSCSPGDPLVLER Sbjct: 1 MLLTSSFSNNHTTWKYAIDIASNSCSPGDPLVLER 35 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 97 HYKTGRDTTSLVPNSCSPGDPLVLER 20 H+ + +++ NSCSPGDPLVLER Sbjct: 3 HFTDTLISANIISNSCSPGDPLVLER 28 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 35.5 bits (78), Expect = 0.066 Identities = 16/20 (80%), Positives = 18/20 (90%), Gaps = 1/20 (5%) Frame = -3 Query: 76 TTSLVP-NSCSPGDPLVLER 20 TT++ P NSCSPGDPLVLER Sbjct: 178 TTTIPPSNSCSPGDPLVLER 197 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 35.5 bits (78), Expect = 0.066 Identities = 18/34 (52%), Positives = 19/34 (55%) Frame = -3 Query: 121 LLAHYLNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 +LA L L G NSCSPGDPLVLER Sbjct: 11 ILARSLGLPAVLGAPELLTASNSCSPGDPLVLER 44 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 35.5 bits (78), Expect = 0.066 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -3 Query: 85 GRDTTSLVPNSCSPGDPLVLER 20 GR S+ NSCSPGDPLVLER Sbjct: 105 GRLKRSVESNSCSPGDPLVLER 126 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 35.5 bits (78), Expect = 0.066 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = -3 Query: 109 YLNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 Y+ H+ T + NSCSPGDPLVLER Sbjct: 48 YIRCHHMD-EPTAKKLSNSCSPGDPLVLER 76 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 LV NSCSPGDPLVLER Sbjct: 3 LVSNSCSPGDPLVLER 18 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 35.5 bits (78), Expect = 0.066 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -3 Query: 106 LNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 L+L + G + + NSCSPGDPLVLER Sbjct: 21 LDLTFTLGSVIIASLSNSCSPGDPLVLER 49 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 LV NSCSPGDPLVLER Sbjct: 17 LVSNSCSPGDPLVLER 32 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 35.5 bits (78), Expect = 0.066 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -3 Query: 88 TGRDTTSLVPNSCSPGDPLVLER 20 T DT V NSCSPGDPLVLER Sbjct: 110 TASDTNE-VSNSCSPGDPLVLER 131 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -3 Query: 94 YKTGRDTTSLVPNSCSPGDPLVLER 20 ++ R +S NSCSPGDPLVLER Sbjct: 56 FRRKRRKSSTTSNSCSPGDPLVLER 80 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 LV NSCSPGDPLVLER Sbjct: 9 LVSNSCSPGDPLVLER 24 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.5 bits (78), Expect = 0.066 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = -3 Query: 124 ILLAHYLNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 I+ H + + + + T S + NSCSPGDPLVLER Sbjct: 13 IVFGHKIAIENSSLKPTFS-ISNSCSPGDPLVLER 46 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 76 TTSLVPNSCSPGDPLVLER 20 T L+ NSCSPGDPLVLER Sbjct: 3 TAILLSNSCSPGDPLVLER 21 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 LV NSCSPGDPLVLER Sbjct: 5 LVSNSCSPGDPLVLER 20 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 LV NSCSPGDPLVLER Sbjct: 2 LVSNSCSPGDPLVLER 17 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 35.5 bits (78), Expect = 0.066 Identities = 19/40 (47%), Positives = 26/40 (65%), Gaps = 5/40 (12%) Frame = -3 Query: 124 ILLAHYLNLHYKTGRDTTSLVP-----NSCSPGDPLVLER 20 +L+ L L+ +T + ++ L P NSCSPGDPLVLER Sbjct: 16 VLVFACLQLNRRTAQTSSPLQPSENVSNSCSPGDPLVLER 55 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 S V NSCSPGDPLVLER Sbjct: 12 SFVSNSCSPGDPLVLER 28 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -3 Query: 76 TTSLVPNSCSPGDPLVLER 20 T L NSCSPGDPLVLER Sbjct: 8 TQELTSNSCSPGDPLVLER 26 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 LV NSCSPGDPLVLER Sbjct: 26 LVSNSCSPGDPLVLER 41 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 LV NSCSPGDPLVLER Sbjct: 26 LVSNSCSPGDPLVLER 41 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 35.5 bits (78), Expect = 0.066 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -3 Query: 76 TTSLVPNSCSPGDPLVLER 20 +T + NSCSPGDPLVLER Sbjct: 34 STQMASNSCSPGDPLVLER 52 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.5 bits (78), Expect = 0.066 Identities = 17/20 (85%), Positives = 17/20 (85%), Gaps = 1/20 (5%) Frame = -3 Query: 76 TTSLVP-NSCSPGDPLVLER 20 T LVP NSCSPGDPLVLER Sbjct: 24 TLPLVPSNSCSPGDPLVLER 43 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 35.5 bits (78), Expect = 0.066 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -3 Query: 100 LHYKTGRDTTSLVPNSCSPGDPLVLER 20 +HY+ R + NSCSPGDPLVLER Sbjct: 40 IHYENKR-RVYVTSNSCSPGDPLVLER 65 >SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -3 Query: 85 GRDTTSLVPNSCSPGDPLVLER 20 GR + + NSCSPGDPLVLER Sbjct: 6 GRASDIVASNSCSPGDPLVLER 27 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 T + NSCSPGDPLVLER Sbjct: 258 TEYISNSCSPGDPLVLER 275 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L+ NSCSPGDPLVLER Sbjct: 17 LISNSCSPGDPLVLER 32 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 76 TTSLVPNSCSPGDPLVLER 20 + S V NSCSPGDPLVLER Sbjct: 11 SASQVSNSCSPGDPLVLER 29 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 97 HYKTGRDTTSLVPNSCSPGDPLVLER 20 H+ + +++ NSCSPGDPLVLER Sbjct: 3 HFTDTLISANILSNSCSPGDPLVLER 28 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 T ++ NSCSPGDPLVLER Sbjct: 10 TKVLSNSCSPGDPLVLER 27 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L+ NSCSPGDPLVLER Sbjct: 37 LISNSCSPGDPLVLER 52 >SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 79 DTTSLVPNSCSPGDPLVLER 20 D S + NSCSPGDPLVLER Sbjct: 6 DVISELSNSCSPGDPLVLER 25 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L+ NSCSPGDPLVLER Sbjct: 8 LISNSCSPGDPLVLER 23 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 T L NSCSPGDPLVLER Sbjct: 4 TGLPSNSCSPGDPLVLER 21 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L+ NSCSPGDPLVLER Sbjct: 24 LISNSCSPGDPLVLER 39 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -3 Query: 76 TTSLVPNSCSPGDPLVLER 20 T ++ NSCSPGDPLVLER Sbjct: 2 TIVIISNSCSPGDPLVLER 20 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L+ NSCSPGDPLVLER Sbjct: 40 LISNSCSPGDPLVLER 55 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L+ NSCSPGDPLVLER Sbjct: 70 LISNSCSPGDPLVLER 85 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L+ NSCSPGDPLVLER Sbjct: 21 LISNSCSPGDPLVLER 36 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -3 Query: 100 LHYKTGRDTTSLVPNSCSPGDPLVLER 20 +H R ++ + NSCSPGDPLVLER Sbjct: 51 VHSSRLRHGSNFLSNSCSPGDPLVLER 77 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L+ NSCSPGDPLVLER Sbjct: 16 LISNSCSPGDPLVLER 31 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 97 HYKTGRDTTSLVPNSCSPGDPLVLER 20 H+ + ++ NSCSPGDPLVLER Sbjct: 3 HFTDTLISANIASNSCSPGDPLVLER 28 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 +L+ NSCSPGDPLVLER Sbjct: 61 TLLSNSCSPGDPLVLER 77 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -3 Query: 82 RDTTSLVPNSCSPGDPLVLER 20 ++ ++ NSCSPGDPLVLER Sbjct: 114 KNQKEIISNSCSPGDPLVLER 134 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 68 PRAEFLQPGGSTSSRA 21 PR EFLQPGGSTSSRA Sbjct: 40 PRIEFLQPGGSTSSRA 55 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +1 Query: 22 ALELVDPPGCRNSARGKLYLSLFCSVS 102 ALELVDPPGCRNS +++F ++ Sbjct: 29 ALELVDPPGCRNSIMDSGLITIFLPIA 55 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -3 Query: 100 LHYKTGRDTTSLVPNSCSPGDPLVLER 20 +H + R NSCSPGDPLVLER Sbjct: 68 VHCRKQRSREVATSNSCSPGDPLVLER 94 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -3 Query: 91 KTGRDTTSLVPNSCSPGDPLVLER 20 KT L NSCSPGDPLVLER Sbjct: 26 KTKNAPLKLSSNSCSPGDPLVLER 49 >SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 82 RDTTSLVPNSCSPGDPLVLER 20 R+ + NSCSPGDPLVLER Sbjct: 5 REAQPVTSNSCSPGDPLVLER 25 >SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -2 Query: 89 NRERYNFPRAEFLQPGGSTSSRA 21 N E N+ EFLQPGGSTSSRA Sbjct: 12 NIEENNYTLIEFLQPGGSTSSRA 34 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -3 Query: 118 LAHYLNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 + H+ + + + V NSCSPGDPLVLER Sbjct: 1 MKHFTDTLISANIISIAFVSNSCSPGDPLVLER 33 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 97 HYKTGRDTTSLVPNSCSPGDPLVLER 20 H+ + ++ NSCSPGDPLVLER Sbjct: 3 HFTDTLISANITSNSCSPGDPLVLER 28 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 +L+ NSCSPGDPLVLER Sbjct: 1 TLLSNSCSPGDPLVLER 17 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +1 Query: 22 ALELVDPPGCRNSARGK 72 ALELVDPPGCRNS + K Sbjct: 12 ALELVDPPGCRNSIKDK 28 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 +V NSCSPGDPLVLER Sbjct: 11 MVSNSCSPGDPLVLER 26 >SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 S+ NSCSPGDPLVLER Sbjct: 33 SITSNSCSPGDPLVLER 49 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -3 Query: 76 TTSLVPNSCSPGDPLVLER 20 T ++ NSCSPGDPLVLER Sbjct: 62 TVFMLSNSCSPGDPLVLER 80 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 +V NSCSPGDPLVLER Sbjct: 1 MVSNSCSPGDPLVLER 16 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 22 ALELVDPPGCRNSARG 69 ALELVDPPGCRNS G Sbjct: 12 ALELVDPPGCRNSIEG 27 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 ++V NSCSPGDPLVLER Sbjct: 18 TVVSNSCSPGDPLVLER 34 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -3 Query: 106 LNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 L++H G L NSCSPGDPLVLER Sbjct: 25 LHIHGLQGEHRV-LTSNSCSPGDPLVLER 52 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 SL NSCSPGDPLVLER Sbjct: 5 SLSSNSCSPGDPLVLER 21 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 S V NSCSPGDPLVLER Sbjct: 15 SKVSNSCSPGDPLVLER 31 >SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 T++ NSCSPGDPLVLER Sbjct: 14 TNISSNSCSPGDPLVLER 31 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 +++ NSCSPGDPLVLER Sbjct: 3 TIISNSCSPGDPLVLER 19 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 +V NSCSPGDPLVLER Sbjct: 6 IVSNSCSPGDPLVLER 21 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 T V NSCSPGDPLVLER Sbjct: 7 TVTVSNSCSPGDPLVLER 24 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 T + NSCSPGDPLVLER Sbjct: 4 TYFISNSCSPGDPLVLER 21 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 +V NSCSPGDPLVLER Sbjct: 1 MVSNSCSPGDPLVLER 16 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 T L NSCSPGDPLVLER Sbjct: 2 TGLRSNSCSPGDPLVLER 19 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 S+ NSCSPGDPLVLER Sbjct: 18 SITSNSCSPGDPLVLER 34 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 ++ NSCSPGDPLVLER Sbjct: 17 IISNSCSPGDPLVLER 32 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -3 Query: 85 GRDTTSLVPNSCSPGDPLVLER 20 G + NSCSPGDPLVLER Sbjct: 9 GASIVQQISNSCSPGDPLVLER 30 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = -3 Query: 127 FILLAHYLNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 F+ L + + R ++ NSCSPGDPLVLER Sbjct: 17 FVPLHAAVCMSLSLARPYDNIASNSCSPGDPLVLER 52 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/20 (75%), Positives = 17/20 (85%), Gaps = 1/20 (5%) Frame = +1 Query: 22 ALELVDPPGCRNS-ARGKLY 78 ALELVDPPGCRNS + K+Y Sbjct: 12 ALELVDPPGCRNSITKDKMY 31 >SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -2 Query: 89 NRERYNFPRAEFLQPGGSTSSRA 21 ++ Y F EFLQPGGSTSSRA Sbjct: 4 DKRYYTFLNIEFLQPGGSTSSRA 26 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 T + NSCSPGDPLVLER Sbjct: 5 TDTLSNSCSPGDPLVLER 22 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 T + NSCSPGDPLVLER Sbjct: 20 TRVTSNSCSPGDPLVLER 37 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 S + NSCSPGDPLVLER Sbjct: 57 SSISNSCSPGDPLVLER 73 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -3 Query: 91 KTGRDTTSLVPNSCSPGDPLVLER 20 + G + NSCSPGDPLVLER Sbjct: 74 RRGAKRQQMASNSCSPGDPLVLER 97 >SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -2 Query: 80 RYNFPRAEFLQPGGSTSSRA 21 +Y + + EFLQPGGSTSSRA Sbjct: 20 KYTWQKIEFLQPGGSTSSRA 39 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -3 Query: 82 RDTTSLVPNSCSPGDPLVLER 20 R+ V NSCSPGDPLVLER Sbjct: 34 REFVLRVSNSCSPGDPLVLER 54 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +1 Query: 22 ALELVDPPGCRNSAR 66 ALELVDPPGCRNS R Sbjct: 12 ALELVDPPGCRNSIR 26 >SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 82 RDTTSLVPNSCSPGDPLVLER 20 RD NSCSPGDPLVLER Sbjct: 6 RDERLSTSNSCSPGDPLVLER 26 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -3 Query: 79 DTTSLVPNSCSPGDPLVLER 20 D + NSCSPGDPLVLER Sbjct: 151 DAVAFPSNSCSPGDPLVLER 170 >SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/43 (48%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = -2 Query: 143 LSQETLYSSCPLS*LTLQNRERYNF--PRAEFLQPGGSTSSRA 21 L Q + S P+ +L N E+ F + EFLQPGGSTSSRA Sbjct: 27 LRQPNIAKSAPIRD-SLSNNEQTRFLNNQIEFLQPGGSTSSRA 68 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = -3 Query: 109 YLNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 +L+ + K+ T L NSCSPGDPLVLER Sbjct: 1 FLDANRKSNASRT-LRSNSCSPGDPLVLER 29 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 +V NSCSPGDPLVLER Sbjct: 3474 VVSNSCSPGDPLVLER 3489 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 S + NSCSPGDPLVLER Sbjct: 2 SQISNSCSPGDPLVLER 18 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/32 (53%), Positives = 22/32 (68%), Gaps = 4/32 (12%) Frame = -3 Query: 103 NLHYKTGRDTTSLVP----NSCSPGDPLVLER 20 N+H + + + L+P NSCSPGDPLVLER Sbjct: 12 NIHCEKIQISNILIPKIASNSCSPGDPLVLER 43 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 ++ NSCSPGDPLVLER Sbjct: 14 IISNSCSPGDPLVLER 29 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 +L NSCSPGDPLVLER Sbjct: 5 TLASNSCSPGDPLVLER 21 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 +V NSCSPGDPLVLER Sbjct: 7 VVSNSCSPGDPLVLER 22 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L+ NSCSPGDPLVLER Sbjct: 54 LLSNSCSPGDPLVLER 69 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 79 DTTSLVPNSCSPGDPLVLER 20 D + V NSCSPGDPLVLER Sbjct: 20 DCHAHVSNSCSPGDPLVLER 39 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 +++ NSCSPGDPLVLER Sbjct: 4 NVISNSCSPGDPLVLER 20 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 T+ + NSCSPGDPLVLER Sbjct: 5 TNGISNSCSPGDPLVLER 22 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 ++ NSCSPGDPLVLER Sbjct: 1 MISNSCSPGDPLVLER 16 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/21 (76%), Positives = 18/21 (85%), Gaps = 2/21 (9%) Frame = -3 Query: 76 TTS--LVPNSCSPGDPLVLER 20 TTS ++ NSCSPGDPLVLER Sbjct: 12 TTSAPVISNSCSPGDPLVLER 32 >SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 S+ NSCSPGDPLVLER Sbjct: 6 SVTSNSCSPGDPLVLER 22 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L+ NSCSPGDPLVLER Sbjct: 1 LLSNSCSPGDPLVLER 16 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L+ NSCSPGDPLVLER Sbjct: 7 LLSNSCSPGDPLVLER 22 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 +L NSCSPGDPLVLER Sbjct: 2 TLASNSCSPGDPLVLER 18 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -3 Query: 79 DTTSLVPNSCSPGDPLVLER 20 ++ L NSCSPGDPLVLER Sbjct: 657 NSLQLASNSCSPGDPLVLER 676 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 +V NSCSPGDPLVLER Sbjct: 27 VVSNSCSPGDPLVLER 42 >SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) Length = 121 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 T + NSCSPGDPLVLER Sbjct: 92 TGISSNSCSPGDPLVLER 109 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 ++ NSCSPGDPLVLER Sbjct: 26 IISNSCSPGDPLVLER 41 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 + L NSCSPGDPLVLER Sbjct: 9 SGLTSNSCSPGDPLVLER 26 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 22 ALELVDPPGCRNSARGKL 75 ALELVDPPGCRNS + K+ Sbjct: 12 ALELVDPPGCRNSMKMKV 29 >SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/26 (65%), Positives = 18/26 (69%) Frame = -3 Query: 97 HYKTGRDTTSLVPNSCSPGDPLVLER 20 H+ TTS NSCSPGDPLVLER Sbjct: 6 HFGLHSQTTS---NSCSPGDPLVLER 28 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 22 ALELVDPPGCRNSARG 69 ALELVDPPGCRNS G Sbjct: 99 ALELVDPPGCRNSITG 114 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 70 SLVPNSCSPGDPLVLER 20 +L NSCSPGDPLVLER Sbjct: 95 ALASNSCSPGDPLVLER 111 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 71 FPRAEFLQPGGSTSSRA 21 F R EFLQPGGSTSSRA Sbjct: 48 FSRIEFLQPGGSTSSRA 64 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 7 VSNSCSPGDPLVLER 21 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -3 Query: 112 HYLNLHYKTGRDTTSLVPNSCSPGDPLVLER 20 +YL + + + +L NSCSPGDPLVLER Sbjct: 6 NYLRIEFLSN-PPKNLRSNSCSPGDPLVLER 35 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/37 (51%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = -3 Query: 121 LLAHYLNLHYKTGRDTTSLVP---NSCSPGDPLVLER 20 LL H L+ ++L P NSCSPGDPLVLER Sbjct: 140 LLQHRLSASKLPQHRVSALPPHLSNSCSPGDPLVLER 176 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 T + NSCSPGDPLVLER Sbjct: 21 TDRLSNSCSPGDPLVLER 38 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/32 (56%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = -3 Query: 112 HYLNLHY-KTGRDTTSLVPNSCSPGDPLVLER 20 +Y+ Y + G T S NSCSPGDPLVLER Sbjct: 6 YYIGRGYLRRGSQTAS---NSCSPGDPLVLER 34 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 2 VSNSCSPGDPLVLER 16 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -3 Query: 79 DTTSLVPNSCSPGDPLVLER 20 + S NSCSPGDPLVLER Sbjct: 9 EINSTASNSCSPGDPLVLER 28 >SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 58 NSCSPGDPLVLERXA 14 NSCSPGDPLVLER A Sbjct: 56 NSCSPGDPLVLERAA 70 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 91 KTGRDTTSLVPNSCSPGDPLVLER 20 KT ++ NSCSPGDPLVLER Sbjct: 10 KTETGRSACPSNSCSPGDPLVLER 33 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 34 VSNSCSPGDPLVLER 48 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 1066 VSNSCSPGDPLVLER 1080 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 ++ NSCSPGDPLVLER Sbjct: 14 VISNSCSPGDPLVLER 29 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -3 Query: 79 DTTSLVPNSCSPGDPLVLER 20 D + + NSCSPGDPLVLER Sbjct: 47 DYVNDISNSCSPGDPLVLER 66 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L NSCSPGDPLVLER Sbjct: 78 LTSNSCSPGDPLVLER 93 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 3 VSNSCSPGDPLVLER 17 >SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -3 Query: 94 YKTGRDTTSLVPNSCSPGDPLVLER 20 Y G NSCSPGDPLVLER Sbjct: 22 YLQGNGQKKNASNSCSPGDPLVLER 46 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 214 VSNSCSPGDPLVLER 228 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 32 VSNSCSPGDPLVLER 46 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L NSCSPGDPLVLER Sbjct: 5 LASNSCSPGDPLVLER 20 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Frame = -3 Query: 130 LFILLAHYLNLHYKTG---RDTTSLVPNSCSPGDPLVLER 20 +F+ H L + + T + L NSCSPGDPLVLER Sbjct: 3 IFVKFLHLLYVWHDTKAPFKPGKHLPSNSCSPGDPLVLER 42 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 5 VSNSCSPGDPLVLER 19 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 3 VSNSCSPGDPLVLER 17 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 80 RYNFPRAEFLQPGGSTSSRA 21 +YN P EFLQPGGSTSSRA Sbjct: 25 QYN-PEIEFLQPGGSTSSRA 43 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 7 VSNSCSPGDPLVLER 21 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 64 VSNSCSPGDPLVLER 78 >SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 T + NSCSPGDPLVLER Sbjct: 8 TCALSNSCSPGDPLVLER 25 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -3 Query: 76 TTSLVPNSCSPGDPLVLER 20 ++S NSCSPGDPLVLER Sbjct: 48 SSSRASNSCSPGDPLVLER 66 >SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 T L NSCSPGDPLVLER Sbjct: 16 TILGSNSCSPGDPLVLER 33 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 82 RDTTSLVPNSCSPGDPLVLER 20 R T NSCSPGDPLVLER Sbjct: 2 RKTGEFGSNSCSPGDPLVLER 22 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 11 VSNSCSPGDPLVLER 25 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 22 ALELVDPPGCRNSARG 69 ALELVDPPGCRNS G Sbjct: 29 ALELVDPPGCRNSIDG 44 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 15 VSNSCSPGDPLVLER 29 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L NSCSPGDPLVLER Sbjct: 17 LASNSCSPGDPLVLER 32 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 59 VSNSCSPGDPLVLER 73 >SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = -2 Query: 143 LSQETLYSSCPLS*LTLQNRERYNFPRAEFLQPGGSTSSRA 21 ++ T YS ++ T+ R + + EFLQPGGSTSSRA Sbjct: 23 MATNTKYSRATMATNTVFARYHGHQSKIEFLQPGGSTSSRA 63 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 31 VSNSCSPGDPLVLER 45 >SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 +S+ NSCSPGDPLVLER Sbjct: 2 SSIGSNSCSPGDPLVLER 19 >SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 97 HYKTGRDTTSLVPNSCSPGDPLVLER 20 H+ + ++ NSCSPGDPLVLER Sbjct: 3 HFTDTLISANIPSNSCSPGDPLVLER 28 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 15 VSNSCSPGDPLVLER 29 >SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 97 HYKTGRDTTSLVPNSCSPGDPLVLER 20 H+ + ++ NSCSPGDPLVLER Sbjct: 3 HFTDTLISANIQSNSCSPGDPLVLER 28 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 73 TSLVPNSCSPGDPLVLER 20 +++ NSCSPGDPLVLER Sbjct: 44 STITSNSCSPGDPLVLER 61 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 6 VSNSCSPGDPLVLER 20 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +1 Query: 22 ALELVDPPGCRNSARGKLYLSL 87 ALELVDPPGCRNS + S+ Sbjct: 12 ALELVDPPGCRNSMNANVSYSI 33 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 15 VSNSCSPGDPLVLER 29 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 18 VSNSCSPGDPLVLER 32 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 30 VSNSCSPGDPLVLER 44 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 82 RDTTSLVPNSCSPGDPLVLER 20 R ++ NSCSPGDPLVLER Sbjct: 18 RSRKTISSNSCSPGDPLVLER 38 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 32 VSNSCSPGDPLVLER 46 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 14 VSNSCSPGDPLVLER 28 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 34 VSNSCSPGDPLVLER 48 >SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/27 (66%), Positives = 20/27 (74%), Gaps = 4/27 (14%) Frame = -3 Query: 88 TGRDTT-SLVP---NSCSPGDPLVLER 20 T RDT ++P NSCSPGDPLVLER Sbjct: 8 TNRDTIYKVLPAPSNSCSPGDPLVLER 34 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L NSCSPGDPLVLER Sbjct: 88 LTSNSCSPGDPLVLER 103 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L NSCSPGDPLVLER Sbjct: 11 LASNSCSPGDPLVLER 26 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -3 Query: 76 TTSLVPNSCSPGDPLVLER 20 TT NSCSPGDPLVLER Sbjct: 8 TTLTRSNSCSPGDPLVLER 26 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 8 VSNSCSPGDPLVLER 22 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 23 VSNSCSPGDPLVLER 37 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 18 VSNSCSPGDPLVLER 32 >SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -2 Query: 71 FPRAEFLQPGGSTSSRA 21 +P EFLQPGGSTSSRA Sbjct: 32 YPNIEFLQPGGSTSSRA 48 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L NSCSPGDPLVLER Sbjct: 11 LASNSCSPGDPLVLER 26 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 27 VSNSCSPGDPLVLER 41 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L NSCSPGDPLVLER Sbjct: 7 LASNSCSPGDPLVLER 22 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 193 VSNSCSPGDPLVLER 207 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 9 VSNSCSPGDPLVLER 23 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 17 VSNSCSPGDPLVLER 31 >SB_5594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -3 Query: 88 TGRDTTSLVPNSCSPGDPLVLER 20 TGR+ + NSCSPGDPLVLER Sbjct: 4 TGREKSG-GSNSCSPGDPLVLER 25 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 ++ NSCSPGDPLVLER Sbjct: 25 VISNSCSPGDPLVLER 40 >SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 97 HYKTGRDTTSLVPNSCSPGDPLVLER 20 H+ + ++ NSCSPGDPLVLER Sbjct: 3 HFTDTLISANIPSNSCSPGDPLVLER 28 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 L NSCSPGDPLVLER Sbjct: 4 LASNSCSPGDPLVLER 19 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 V NSCSPGDPLVLER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 + NSCSPGDPLVLER Sbjct: 5 ISNSCSPGDPLVLER 19 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 + NSCSPGDPLVLER Sbjct: 101 ISNSCSPGDPLVLER 115 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 22 ALELVDPPGCRNSARG 69 ALELVDPPGCRNS G Sbjct: 12 ALELVDPPGCRNSMIG 27 >SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 33.5 bits (73), Expect = 0.27 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 86 RERYNFPRAEFLQPGGSTSSRA 21 + RY P EFLQPGGSTSSRA Sbjct: 141 KNRYG-PAIEFLQPGGSTSSRA 161 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 + NSCSPGDPLVLER Sbjct: 21 ISNSCSPGDPLVLER 35 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = +1 Query: 22 ALELVDPPGCRNSARGKLYLSL 87 ALELVDPPGCRNS + Y+ L Sbjct: 88 ALELVDPPGCRNSMIYENYILL 109 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 + NSCSPGDPLVLER Sbjct: 9 ISNSCSPGDPLVLER 23 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 + NSCSPGDPLVLER Sbjct: 10 ISNSCSPGDPLVLER 24 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 64 VPNSCSPGDPLVLER 20 + NSCSPGDPLVLER Sbjct: 3 ISNSCSPGDPLVLER 17 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -3 Query: 67 LVPNSCSPGDPLVLER 20 ++ NSCSPGDPLVLER Sbjct: 55 ILSNSCSPGDPLVLER 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,338,863 Number of Sequences: 59808 Number of extensions: 634274 Number of successful extensions: 4032 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4028 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2907797044 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -