BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0792 (728 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 2.9 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 3.9 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 5.2 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 22 6.8 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 22 6.8 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/54 (18%), Positives = 22/54 (40%) Frame = -3 Query: 576 HTWRMPTLTFVPACRATSH*VHTEFSEIYSPVAVRIECAEYVFCELTSVTVREK 415 HT+ + C+ + ++ Y P+ V I+ +FC + + E+ Sbjct: 184 HTYSETGPSHCVVCQNFFYQIYATLGSFYIPLFVMIQVYYKIFCAARRIVLEER 237 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 564 FSMYDLDGNGYISRQEM 614 FS YD + NG + R+E+ Sbjct: 242 FSHYDRNNNGNLEREEL 258 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -3 Query: 609 PALRCIRFHLSHTWRMPTLTFVPAC 535 P++ CI F+ +P T+ P C Sbjct: 135 PSVECIVFNSGTILCVPFTTYTPVC 159 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.8 bits (44), Expect = 6.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 521 TKCTRNSLKSIVPSPFASNVRN 456 + CTR S + VPS NV N Sbjct: 14 SSCTRPSRGNAVPSSQRGNVHN 35 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.8 bits (44), Expect = 6.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 521 TKCTRNSLKSIVPSPFASNVRN 456 + CTR S + VPS NV N Sbjct: 14 SSCTRPSRGNAVPSSQRGNVHN 35 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 224,688 Number of Sequences: 438 Number of extensions: 5565 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -