BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0792 (728 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g24620.1 68414.m03097 polcalcin, putative / calcium-binding p... 40 0.001 At4g16350.1 68417.m02477 calcineurin B-like protein 6 (CBL6) ide... 40 0.002 At4g26570.2 68417.m03831 calcineurin B-like protein 3 (CBL3) ide... 39 0.004 At4g26570.1 68417.m03830 calcineurin B-like protein 3 (CBL3) ide... 39 0.004 At5g55990.1 68418.m06986 calcineurin B-like protein 2 (CBL2) ide... 38 0.009 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 37 0.012 At5g24270.1 68418.m02855 calcineurin B-like protein, putative / ... 37 0.012 At4g17615.2 68417.m02635 calcineurin B-like protein 1 (CBL1) ide... 37 0.016 At4g17615.1 68417.m02634 calcineurin B-like protein 1 (CBL1) ide... 37 0.016 At2g43290.1 68415.m05382 calmodulin-like protein (MSS3) identica... 37 0.016 At4g03290.1 68417.m00449 calcium-binding protein, putative simil... 36 0.021 At4g01420.1 68417.m00182 calcineurin B-like protein 5 (CBL5) ide... 36 0.028 At3g51850.1 68416.m05686 calcium-dependent protein kinase, putat... 36 0.028 At5g47100.1 68418.m05807 calcineurin B-like protein 9 (CBL9) ide... 35 0.064 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 35 0.064 At4g33000.2 68417.m04694 calcineurin B-like protein 10 (CBL10) i... 35 0.064 At4g33000.1 68417.m04693 calcineurin B-like protein 10 (CBL10) i... 35 0.064 At3g59440.1 68416.m06630 calcium-binding protein, putative simil... 34 0.084 At1g05990.1 68414.m00627 calcium-binding protein, putative stron... 34 0.084 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 34 0.11 At5g37770.1 68418.m04547 touch-responsive protein / calmodulin-r... 33 0.15 At4g12860.1 68417.m02014 calcium-binding protein, putative simil... 33 0.15 At3g25600.1 68416.m03187 calmodulin, putative similar to calmodu... 33 0.19 At4g04710.1 68417.m00692 calcium-dependent protein kinase, putat... 33 0.26 At3g07490.1 68416.m00893 calcium-binding protein, putative simil... 33 0.26 At2g32450.1 68415.m03964 calcium-binding EF hand family protein ... 32 0.34 At1g18530.1 68414.m02312 calmodulin, putative similar to calmodu... 32 0.34 At5g66210.2 68418.m08341 calcium-dependent protein kinase family... 32 0.45 At5g66210.1 68418.m08340 calcium-dependent protein kinase family... 32 0.45 At4g26560.1 68417.m03828 calcineurin B-like protein, putative si... 32 0.45 At5g17480.1 68418.m02051 polcalcin, putative / calcium-binding p... 31 0.59 At4g35310.1 68417.m05019 calcium-dependent protein kinase, putat... 31 0.59 At3g03430.1 68416.m00341 polcalcin, putative / calcium-binding p... 31 0.59 At5g42380.1 68418.m05160 calmodulin-related protein, putative si... 31 0.78 At2g17890.1 68415.m02072 calcium-dependent protein kinase family... 31 0.78 At2g17290.1 68415.m01997 calcium-dependent protein kinase isofor... 31 0.78 At4g36070.1 68417.m05135 calcium-dependent protein kinase family... 31 1.0 At4g20780.1 68417.m03017 calcium-binding protein, putative simil... 31 1.0 At3g03000.1 68416.m00295 calmodulin, putative similar to calmodu... 31 1.0 At2g38910.1 68415.m04783 calcium-dependent protein kinase, putat... 31 1.0 At1g32250.1 68414.m03967 calmodulin, putative similar to calmodu... 31 1.0 At1g21550.1 68414.m02695 calcium-binding protein, putative conta... 31 1.0 At2g41090.1 68415.m05075 calmodulin-like calcium-binding protein... 30 1.4 At1g76650.1 68414.m08919 calcium-binding EF hand family protein ... 30 1.4 At1g74740.1 68414.m08660 calcium-dependent protein kinase, putat... 30 1.4 At1g05150.1 68414.m00518 calcium-binding EF hand family protein ... 30 1.4 At5g44460.1 68418.m05448 calcium-binding protein, putative simil... 30 1.8 At4g09570.1 68417.m01575 calcium-dependent protein kinase, putat... 30 1.8 At2g15680.1 68415.m01795 calmodulin-related protein, putative si... 30 1.8 At3g22930.1 68416.m02889 calmodulin, putative strong similarity ... 29 2.4 At5g39670.1 68418.m04804 calcium-binding EF hand family protein ... 29 3.2 At5g23580.1 68418.m02767 calcium-dependent protein kinase 9 (CDP... 29 3.2 At4g38230.1 68417.m05399 calcium-dependent protein kinase, putat... 29 3.2 At4g38170.1 68417.m05389 far-red impaired responsive protein, pu... 29 3.2 At4g04740.1 68417.m00695 calcium-dependent protein kinase, putat... 29 3.2 At3g03400.1 68416.m00337 calmodulin-related protein, putative si... 29 3.2 At2g41410.1 68415.m05110 calmodulin, putative identical to SP|P3... 29 3.2 At2g36180.1 68415.m04440 calmodulin-related protein, putative si... 29 3.2 At1g35670.1 68414.m04435 calcium-dependent protein kinase 2 (CDP... 29 3.2 At5g17470.1 68418.m02050 calmodulin-related protein, putative si... 29 4.2 At4g27790.1 68417.m03991 calcium-binding EF hand family protein ... 29 4.2 At4g18250.1 68417.m02710 receptor serine/threonine kinase, putat... 29 4.2 At2g41100.2 68415.m05077 touch-responsive protein / calmodulin-r... 29 4.2 At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-r... 29 4.2 At5g12180.1 68418.m01429 calcium-dependent protein kinase, putat... 28 5.5 At5g08580.1 68418.m01021 calcium-binding EF hand family protein ... 28 5.5 At3g61810.1 68416.m06937 glycosyl hydrolase family 17 protein si... 28 5.5 At3g51920.1 68416.m05695 calmodulin-9 (CAM9) identical to calmod... 28 5.5 At3g50770.1 68416.m05560 calmodulin-related protein, putative si... 28 5.5 At3g03410.1 68416.m00339 calmodulin-related protein, putative si... 28 5.5 At2g45670.1 68415.m05678 calcineurin B subunit-related contains ... 28 5.5 At1g61950.1 68414.m06988 calcium-dependent protein kinase, putat... 28 5.5 At5g37780.1 68418.m04549 calmodulin-1/4 (CAM1) identical to calm... 28 7.3 At5g21274.1 68418.m02533 calmodulin-6 (CAM6) identical to calmod... 28 7.3 At5g19360.1 68418.m02307 calcium-dependent protein kinase, putat... 28 7.3 At3g56800.1 68416.m06317 calmodulin-2/3/5 (CAM3) identical to ca... 28 7.3 At3g43810.1 68416.m04682 calmodulin-7 (CAM7) almost identical to... 28 7.3 At2g41110.1 68415.m05078 calmodulin-2/3/5 (CAM2) (CAL1) almost i... 28 7.3 At2g27030.3 68415.m03247 calmodulin-2/3/5 (CAM5) (TCH1) identica... 28 7.3 At2g27030.1 68415.m03245 calmodulin-2/3/5 (CAM5) (TCH1) identica... 28 7.3 At1g66410.1 68414.m07542 calmodulin-1/4 (CAM4) identical to calm... 28 7.3 At1g03960.2 68414.m00382 calcium-binding EF hand family protein ... 28 7.3 At1g03960.1 68414.m00381 calcium-binding EF hand family protein ... 28 7.3 At3g28850.1 68416.m03599 glutaredoxin family protein 27 9.6 At3g24110.1 68416.m03027 calcium-binding EF hand family protein ... 27 9.6 >At1g24620.1 68414.m03097 polcalcin, putative / calcium-binding pollen allergen, putative similar to polcalcin Jun o 2 (calcium-binding pollen allergen Jun o 2) SP:O64943 from [Juniperus oxycedrus] Length = 186 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/44 (43%), Positives = 30/44 (68%) Frame = +3 Query: 546 QKLKWAFSMYDLDGNGYISRQEMLEIVTAIYQDGGAPL*RCRKM 677 + LK AFS+YD+DGNG IS +E+ E++ ++ + + CRKM Sbjct: 109 ENLKDAFSVYDIDGNGSISAEELHEVLRSLGDE--CSIAECRKM 150 Score = 32.3 bits (70), Expect = 0.34 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +1 Query: 370 SGHLSVEEFKKIYGNFFPYGDASKFAE--HVFRTFDANGDGTIDFREFRV 513 +G +S EE ++ + GD AE + D +GDGTIDF EF++ Sbjct: 123 NGSISAEELHEVLRSL---GDECSIAECRKMIGGVDKDGDGTIDFEEFKI 169 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 448 EHVFRTFDANGDGTIDFRE 504 E VF+ FD NGDG I +E Sbjct: 39 EAVFKKFDVNGDGKISSKE 57 >At4g16350.1 68417.m02477 calcineurin B-like protein 6 (CBL6) identical to calcineurin B-like protein 6 (GI:11065943) [Arabidopsis thaliana] Length = 226 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 495 FQRIPCALSVTS-RGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYQDGGAPL 659 F+ +LSV K E K++++F +YDL+ GYI RQE+ ++V + G L Sbjct: 98 FEAFARSLSVFHPNAKFEDKIEFSFKLYDLNQQGYIKRQEVKQMVVRTLAESGMNL 153 Score = 36.3 bits (80), Expect = 0.021 Identities = 22/72 (30%), Positives = 35/72 (48%) Frame = +1 Query: 292 EDLKQNTEFSDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFD 471 +D+ + T F+ EI+ Y+ F +G + E+F+ + F S FA+ VF FD Sbjct: 32 KDVARGTVFTVNEIEALYELFKSISKNGLIDKEQFQLVL--FKMNTTRSLFADRVFDLFD 89 Query: 472 ANGDGTIDFREF 507 G +DF F Sbjct: 90 TKNTGILDFEAF 101 >At4g26570.2 68417.m03831 calcineurin B-like protein 3 (CBL3) identical to calcineurin B-like protein 3 (GI:22136404) [Arabidopsis thaliana] Length = 230 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 495 FQRIPCALSVTS-RGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYQDGGAPL 659 F+ ALSV +E K+ ++F +YDL G+I RQE+ ++V A + G L Sbjct: 108 FEEFARALSVFHPNAPIEDKIDFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNL 163 >At4g26570.1 68417.m03830 calcineurin B-like protein 3 (CBL3) identical to calcineurin B-like protein 3 (GI:22136404) [Arabidopsis thaliana] Length = 226 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 495 FQRIPCALSVTS-RGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYQDGGAPL 659 F+ ALSV +E K+ ++F +YDL G+I RQE+ ++V A + G L Sbjct: 104 FEEFARALSVFHPNAPIEDKIDFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNL 159 Score = 32.7 bits (71), Expect = 0.26 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 4/76 (5%) Frame = +1 Query: 292 EDLKQNTEFSDAEIQEWYKGFLKDCPS----GHLSVEEFKKIYGNFFPYGDASKFAEHVF 459 E L + T FS +EI+ Y+ F K + G ++ EEF+ F S FA+ VF Sbjct: 34 ELLARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLAL--FKTNKKESLFADRVF 91 Query: 460 RTFDANGDGTIDFREF 507 FD +G + F EF Sbjct: 92 DLFDTKHNGILGFEEF 107 >At5g55990.1 68418.m06986 calcineurin B-like protein 2 (CBL2) identical to calcineurin B-like protein 2 GI:3309084 from [Arabidopsis thaliana] Length = 226 Score = 37.5 bits (83), Expect = 0.009 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 495 FQRIPCALSVTS-RGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYQDGGAPL 659 F+ ALSV ++ K+ ++F +YDL G+I RQE+ ++V A + G L Sbjct: 104 FEEFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNL 159 Score = 33.1 bits (72), Expect = 0.19 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 4/76 (5%) Frame = +1 Query: 292 EDLKQNTEFSDAEIQEWYKGFLKDCPS----GHLSVEEFKKIYGNFFPYGDASKFAEHVF 459 E L ++T FS +EI+ Y+ F K + G ++ EEF+ F S FA+ VF Sbjct: 34 ELLARDTVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLAL--FKTNKKESLFADRVF 91 Query: 460 RTFDANGDGTIDFREF 507 FD +G + F EF Sbjct: 92 DLFDTKHNGILGFEEF 107 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 37.1 bits (82), Expect = 0.012 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%) Frame = +1 Query: 286 VLEDLKQNTEFSDAEIQEWYKGFLKDCPSGHLSVEEFKK-IYGNFFPYGDASKFAEHVFR 462 VL L++ E D I+ + F + G+L + +K + P G K+A+ +FR Sbjct: 26 VLLALRETREERDLRIRSLFSFFDSE-NVGYLDCAQIEKGLCALQIPSG--YKYAKELFR 82 Query: 463 TFDANGDGTIDFREFRVHL 519 DAN DG +D+ EFR ++ Sbjct: 83 VCDANRDGRVDYHEFRRYM 101 >At5g24270.1 68418.m02855 calcineurin B-like protein, putative / calcium sensor homolog (SOS3) identical to calcium sensor homolog [Arabidopsis thaliana] GI:3309575; similar to calcineurin B-like protein 8 (GI:15866276) [Arabidopsis thaliana] Length = 222 Score = 37.1 bits (82), Expect = 0.012 Identities = 14/35 (40%), Positives = 25/35 (71%) Frame = +3 Query: 540 LEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYQD 644 + +K+K+AF +YDL G+I R+E+ E+V A+ + Sbjct: 109 VHEKVKFAFKLYDLRQTGFIEREELKEMVVALLHE 143 Score = 33.9 bits (74), Expect = 0.11 Identities = 28/93 (30%), Positives = 44/93 (47%), Gaps = 7/93 (7%) Frame = +1 Query: 250 NKGKQNSKLKPEVLED---LKQNTEFSDAEIQEWYKGFLKDCPS----GHLSVEEFKKIY 408 +K K+ + ++P ED L T F+ E++ Y+ F K S G + EEF+ Sbjct: 6 SKKKKKNAMRPPGYEDPELLASVTPFTVEEVEALYELFKKLSSSIIDDGLIHKEEFQLAL 65 Query: 409 GNFFPYGDASKFAEHVFRTFDANGDGTIDFREF 507 F + FA+ +F FD +G I+F EF Sbjct: 66 --FRNRNRRNLFADRIFDVFDVKRNGVIEFGEF 96 >At4g17615.2 68417.m02635 calcineurin B-like protein 1 (CBL1) identical to calcineurin B-like protein 1 (GI:3309082) [Arabidopsis thaliana] Length = 171 Score = 36.7 bits (81), Expect = 0.016 Identities = 14/32 (43%), Positives = 23/32 (71%) Frame = +3 Query: 540 LEQKLKWAFSMYDLDGNGYISRQEMLEIVTAI 635 LE K+ + F +YD+D GYI RQE+ +++ A+ Sbjct: 63 LEDKIDFTFRLYDMDCTGYIERQEVKQMLIAL 94 >At4g17615.1 68417.m02634 calcineurin B-like protein 1 (CBL1) identical to calcineurin B-like protein 1 (GI:3309082) [Arabidopsis thaliana] Length = 213 Score = 36.7 bits (81), Expect = 0.016 Identities = 14/32 (43%), Positives = 23/32 (71%) Frame = +3 Query: 540 LEQKLKWAFSMYDLDGNGYISRQEMLEIVTAI 635 LE K+ + F +YD+D GYI RQE+ +++ A+ Sbjct: 105 LEDKIDFTFRLYDMDCTGYIERQEVKQMLIAL 136 Score = 27.5 bits (58), Expect = 9.6 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 4/74 (5%) Frame = +1 Query: 298 LKQNTEFSDAEIQEWYKGFLKDCPS----GHLSVEEFKKIYGNFFPYGDASKFAEHVFRT 465 L T FS +E++ ++ F S G ++ EEF+ F + FA +F Sbjct: 21 LASETAFSVSEVEALFELFKSISSSVVDDGLINKEEFQLAL--FKSRKRENIFANRIFDM 78 Query: 466 FDANGDGTIDFREF 507 FD G IDF +F Sbjct: 79 FDVKRKGVIDFGDF 92 >At2g43290.1 68415.m05382 calmodulin-like protein (MSS3) identical to calmodulin-like MSS3 from GI:9965747 [Arabidopsis thaliana] Length = 215 Score = 36.7 bits (81), Expect = 0.016 Identities = 15/45 (33%), Positives = 30/45 (66%) Frame = +3 Query: 543 EQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYQDGGAPL*RCRKM 677 E+ +K AF+++D DG+G+I+ +E+ ++ ++ G L C+KM Sbjct: 141 EEDMKDAFNVFDQDGDGFITVEELKSVMASLGLKQGKTLDGCKKM 185 Score = 31.9 bits (69), Expect = 0.45 Identities = 17/79 (21%), Positives = 40/79 (50%), Gaps = 1/79 (1%) Frame = +1 Query: 274 LKPEVLEDLKQNTEFSDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNF-FPYGDASKFAE 450 L ++++ + E + ++++ + F +D G ++VEE K + + G + Sbjct: 125 LYSSIVDEHHNDGETEEEDMKDAFNVFDQD-GDGFITVEELKSVMASLGLKQGKTLDGCK 183 Query: 451 HVFRTFDANGDGTIDFREF 507 + DA+GDG ++++EF Sbjct: 184 KMIMQVDADGDGRVNYKEF 202 Score = 27.5 bits (58), Expect = 9.6 Identities = 20/87 (22%), Positives = 34/87 (39%) Frame = +1 Query: 247 QNKGKQNSKLKPEVLEDLKQNTEFSDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPY 426 +N S + P +E++ ++ F K+ G ++ EE N Y Sbjct: 38 KNSPPSPSTMLPSPSSSSAPTKRIDPSELKRVFQMFDKN-GDGRITKEELNDSLENLGIY 96 Query: 427 GDASKFAEHVFRTFDANGDGTIDFREF 507 + + + DANGDG +D EF Sbjct: 97 IPDKDLTQMIHK-IDANGDGCVDIDEF 122 >At4g03290.1 68417.m00449 calcium-binding protein, putative similar to calcium-binding protein [Lotus japonicus] GI:18413495; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 154 Score = 36.3 bits (80), Expect = 0.021 Identities = 15/45 (33%), Positives = 30/45 (66%) Frame = +3 Query: 543 EQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYQDGGAPL*RCRKM 677 E+ +K AF+++D +G+G+I+ E+ +++++ G L CRKM Sbjct: 79 EEDMKEAFNVFDRNGDGFITVDELKAVLSSLGLKQGKTLEECRKM 123 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/72 (20%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +1 Query: 298 LKQNTEFSDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNF-FPYGDASKFAEHVFRTFDA 474 ++ E + +++E + F ++ G ++V+E K + + G + + D Sbjct: 71 VEDEDEVGEEDMKEAFNVFDRN-GDGFITVDELKAVLSSLGLKQGKTLEECRKMIMQVDV 129 Query: 475 NGDGTIDFREFR 510 +GDG +++ EFR Sbjct: 130 DGDGRVNYMEFR 141 >At4g01420.1 68417.m00182 calcineurin B-like protein 5 (CBL5) identical to calcineurin B-like protein 5 (GI:9965366) [Arabidopsis thaliana]; similar to N. crassa calcineurin calcium-regulated protein phosphatase, GenBank accession number P87072 Length = 203 Score = 35.9 bits (79), Expect = 0.028 Identities = 32/90 (35%), Positives = 43/90 (47%), Gaps = 4/90 (4%) Frame = +1 Query: 259 KQNSKLKPEVLEDLKQNTEFSDAEIQEWYKGFLK--DCPSGH--LSVEEFKKIYGNFFPY 426 KQ + E + L T FS+AE++ + F+K C S L+ E+F+ I Sbjct: 7 KQLEGRRQEDISLLASQTFFSEAEVEVLHGLFIKLTSCLSNDNLLTKEKFQFILIKNTKK 66 Query: 427 GDASKFAEHVFRTFDANGDGTIDFREFRVH 516 S AE +F FD DG IDF EF VH Sbjct: 67 RSLS--AERIFGLFDMRNDGAIDFGEF-VH 93 >At3g51850.1 68416.m05686 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 528 Score = 35.9 bits (79), Expect = 0.028 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = +3 Query: 543 EQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYQDGG 650 ++ L+ AFS +D DGNGYI QE+ + A+ +DGG Sbjct: 429 DEHLRKAFSYFDKDGNGYILPQELCD---ALKEDGG 461 >At5g47100.1 68418.m05807 calcineurin B-like protein 9 (CBL9) identical to calcineurin B-like protein 9 (GI:5866279) and calcium-binding protein AtCBL9 (GI:16151825) [Arabidopsis thaliana]; similar to calcineurin B-like protein 1 (GI:3309082) [Arabidopsis thaliana] Length = 213 Score = 34.7 bits (76), Expect = 0.064 Identities = 13/32 (40%), Positives = 23/32 (71%) Frame = +3 Query: 540 LEQKLKWAFSMYDLDGNGYISRQEMLEIVTAI 635 LE+K + F +YD+D G+I RQE+ +++ A+ Sbjct: 105 LEEKTDFTFRLYDMDCTGFIERQEVKQMLIAL 136 Score = 29.5 bits (63), Expect = 2.4 Identities = 23/74 (31%), Positives = 33/74 (44%), Gaps = 4/74 (5%) Frame = +1 Query: 298 LKQNTEFSDAEIQEWYKGFLKDCPS----GHLSVEEFKKIYGNFFPYGDASKFAEHVFRT 465 L T FS +E++ Y+ F S G ++ EEF+ F + FA +F Sbjct: 21 LASETAFSVSEVEALYELFKSISSSVVDDGLINKEEFQLAL--FKNRKKENLFANRIFDL 78 Query: 466 FDANGDGTIDFREF 507 FD G IDF +F Sbjct: 79 FDVKRKGVIDFGDF 92 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 34.7 bits (76), Expect = 0.064 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +1 Query: 439 KFAEHVFRTFDANGDGTIDFREFRVHL 519 K+A +FR DAN DG +D++EFR ++ Sbjct: 72 KYARDLFRVCDANRDGRVDYQEFRRYI 98 >At4g33000.2 68417.m04694 calcineurin B-like protein 10 (CBL10) identical to calcineurin B-like protein 10 [Arabidopsis thaliana] GI:29150248 Length = 246 Score = 34.7 bits (76), Expect = 0.064 Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = +3 Query: 495 FQRIPCALSVTSR-GKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAI 635 F+ ALSV +++K +AF +YDL G+I R+E+ ++V+AI Sbjct: 125 FEEFIHALSVFHPYASIQEKTDFAFRLYDLRQTGFIEREEVQQMVSAI 172 >At4g33000.1 68417.m04693 calcineurin B-like protein 10 (CBL10) identical to calcineurin B-like protein 10 [Arabidopsis thaliana] GI:29150248 Length = 256 Score = 34.7 bits (76), Expect = 0.064 Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = +3 Query: 495 FQRIPCALSVTSR-GKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAI 635 F+ ALSV +++K +AF +YDL G+I R+E+ ++V+AI Sbjct: 135 FEEFIHALSVFHPYASIQEKTDFAFRLYDLRQTGFIEREEVQQMVSAI 182 >At3g59440.1 68416.m06630 calcium-binding protein, putative similar to calcium-binding protein [Lotus japonicus] GI:18413495 Length = 195 Score = 34.3 bits (75), Expect = 0.084 Identities = 15/47 (31%), Positives = 31/47 (65%) Frame = +3 Query: 537 KLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYQDGGAPL*RCRKM 677 K E ++ AF+++D DG+G+I+ +E+ ++T++ G L C++M Sbjct: 119 KEEGDMRDAFNVFDQDGDGFITVEELNSVMTSLGLKQGKTLECCKEM 165 >At1g05990.1 68414.m00627 calcium-binding protein, putative strong similarity to calcium-binding protein [Lotus japonicus] GI:18413495; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 150 Score = 34.3 bits (75), Expect = 0.084 Identities = 14/45 (31%), Positives = 30/45 (66%) Frame = +3 Query: 543 EQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYQDGGAPL*RCRKM 677 E+ +K AF+++D +G+G+I+ E+ +++++ G L C+KM Sbjct: 77 EEDMKEAFNVFDQNGDGFITVDELKAVLSSLGLKQGKTLDDCKKM 121 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/77 (19%), Positives = 39/77 (50%), Gaps = 1/77 (1%) Frame = +1 Query: 283 EVLEDLKQNTEFSDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNF-FPYGDASKFAEHVF 459 E+ + + + + +++E + F ++ G ++V+E K + + G + + Sbjct: 64 ELYKTIMDEEDEEEEDMKEAFNVFDQN-GDGFITVDELKAVLSSLGLKQGKTLDDCKKMI 122 Query: 460 RTFDANGDGTIDFREFR 510 + D +GDG ++++EFR Sbjct: 123 KKVDVDGDGRVNYKEFR 139 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +1 Query: 373 GHLSVEEFKKIYGNFFPYGDASKF-AEHVFRTFDANGDGTIDFREFRVHL 519 G + ++EF ++Y D + + F FD NGDG I E + L Sbjct: 55 GCVDIDEFGELYKTIMDEEDEEEEDMKEAFNVFDQNGDGFITVDELKAVL 104 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 448 EHVFRTFDANGDGTIDFRE 504 + VF+ FD NGDGTI +E Sbjct: 7 KRVFQMFDKNGDGTITGKE 25 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 33.9 bits (74), Expect = 0.11 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 1/92 (1%) Frame = +1 Query: 247 QNKGKQNSKLKPE-VLEDLKQNTEFSDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFP 423 QN GK+ + E VL L++ E + IQ+ ++ F + G L + +K + Sbjct: 8 QNPGKKPVEATMEHVLVALRETKEKREIRIQKLFE-FFDNSKLGFLDDTQIEKGLSSL-S 65 Query: 424 YGDASKFAEHVFRTFDANGDGTIDFREFRVHL 519 ++A + D+N DG +D++EFR ++ Sbjct: 66 IPPKYRYASDFLKVCDSNRDGRVDYQEFRRYM 97 >At5g37770.1 68418.m04547 touch-responsive protein / calmodulin-related protein 2, touch-induced (TCH2) identical to calmodulin-related protein 2,touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 161 Score = 33.5 bits (73), Expect = 0.15 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +3 Query: 552 LKWAFSMYDLDGNGYISRQEMLEIV 626 LK AF +YDLDGNG IS +E+ ++ Sbjct: 95 LKEAFELYDLDGNGRISAKELHSVM 119 >At4g12860.1 68417.m02014 calcium-binding protein, putative similar to calcium-binding protein GI:6580549 from [Lotus japonicus] Length = 152 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +1 Query: 373 GHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFR 510 G + ++EF +Y + + FR FD NGDG I E R Sbjct: 55 GAMDIDEFGSLYQEMVEEKEEEEDMREAFRVFDQNGDGFITDEELR 100 Score = 33.1 bits (72), Expect = 0.19 Identities = 13/45 (28%), Positives = 29/45 (64%) Frame = +3 Query: 543 EQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYQDGGAPL*RCRKM 677 E+ ++ AF ++D +G+G+I+ +E+ ++ ++ G L C+KM Sbjct: 76 EEDMREAFRVFDQNGDGFITDEELRSVLASMGLKQGRTLEDCKKM 120 >At3g25600.1 68416.m03187 calmodulin, putative similar to calmodulin GI:239841 from [Paramecium tetraurelia] Length = 161 Score = 33.1 bits (72), Expect = 0.19 Identities = 24/100 (24%), Positives = 47/100 (47%), Gaps = 2/100 (2%) Frame = +1 Query: 250 NKGKQNSKLKPEVLEDLKQNTEFSDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYG 429 N + +L +L D+ + + ++ E ++ F +D +G ++ E + G+ G Sbjct: 61 NGSVEFDELVVAILPDINEEVLINQEQLMEVFRSFDRD-GNGSITAAE---LAGSMAKMG 116 Query: 430 DASKFAE--HVFRTFDANGDGTIDFREFRVHLV*RRAASW 543 + E + D+NGDG I F EF H++ + AA + Sbjct: 117 HPLTYRELTEMMTEADSNGDGVISFNEFS-HIMAKSAADF 155 >At4g04710.1 68417.m00692 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 575 Score = 32.7 bits (71), Expect = 0.26 Identities = 22/62 (35%), Positives = 33/62 (53%) Frame = +1 Query: 322 DAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFR 501 D + + ++ F KD SGH++ EE + I GD + A+ + FD N DG ID+ Sbjct: 408 DEHLYKAFQYFDKD-GSGHITKEEVE-IAMKEHGMGDEAN-AKDLISEFDKNNDGKIDYE 464 Query: 502 EF 507 EF Sbjct: 465 EF 466 >At3g07490.1 68416.m00893 calcium-binding protein, putative similar to calcium-binding protein GI:6580549 from [Lotus japonicus] Length = 153 Score = 32.7 bits (71), Expect = 0.26 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +1 Query: 373 GHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFR 510 G++ +EEF +Y D + F FD N DG I E R Sbjct: 55 GYVDIEEFGGLYQTIMEERDEEEDMREAFNVFDQNRDGFITVEELR 100 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/45 (24%), Positives = 29/45 (64%) Frame = +3 Query: 543 EQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYQDGGAPL*RCRKM 677 E+ ++ AF+++D + +G+I+ +E+ ++ ++ G L C++M Sbjct: 76 EEDMREAFNVFDQNRDGFITVEELRSVLASLGLKQGRTLEDCKRM 120 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +1 Query: 373 GHLSVEEFKKIYGNF-FPYGDASKFAEHVFRTFDANGDGTIDFREFR 510 G ++VEE + + + G + + + D +GDG ++F+EF+ Sbjct: 92 GFITVEELRSVLASLGLKQGRTLEDCKRMISKVDVDGDGMVNFKEFK 138 >At2g32450.1 68415.m03964 calcium-binding EF hand family protein low similarity to O-linked GlcNAc transferase [Homo sapiens] GI:2266994; contains Pfam profiles PF00036: EF hand, PF00515: TPR Domain Length = 802 Score = 32.3 bits (70), Expect = 0.34 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +3 Query: 522 VTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAI 635 +T+RG +K+K F +D + +G +SR+EM +V A+ Sbjct: 1 MTTRGSRSEKVKRIFQQFDGNLDGGLSREEMSALVVAV 38 >At1g18530.1 68414.m02312 calmodulin, putative similar to calmodulin GI:1565285 from [Toxoplasma gondii] Length = 157 Score = 32.3 bits (70), Expect = 0.34 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 2/76 (2%) Frame = +1 Query: 286 VLEDLKQNTEFSDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAE--HVF 459 +L DL + + ++ E +K F +D +G +S E + G G + E + Sbjct: 68 ILPDLNEEVLINSEQLLEIFKSFDRD-GNGFISAAE---LAGAMAKMGQPLTYKELTEMI 123 Query: 460 RTFDANGDGTIDFREF 507 + D NGDG I F EF Sbjct: 124 KEADTNGDGVISFGEF 139 >At5g66210.2 68418.m08341 calcium-dependent protein kinase family protein / CDPK family protein contains Pfam domains, PF00069: Protein kinase domain and PF00036: EF hand Length = 523 Score = 31.9 bits (69), Expect = 0.45 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 1/81 (1%) Frame = +1 Query: 268 SKLKPEVLEDLKQNTEFSD-AEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKF 444 S+LK L L + ++ +++++ + D +G +S+EE ++ P+ Sbjct: 348 SRLKQFALRALASTLDEAEISDLRDQFDAIDVD-KNGVISLEEMRQALAKDLPWKLKDSR 406 Query: 445 AEHVFRTFDANGDGTIDFREF 507 + D+N DG +DF EF Sbjct: 407 VAEILEAIDSNTDGLVDFTEF 427 >At5g66210.1 68418.m08340 calcium-dependent protein kinase family protein / CDPK family protein contains Pfam domains, PF00069: Protein kinase domain and PF00036: EF hand Length = 523 Score = 31.9 bits (69), Expect = 0.45 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 1/81 (1%) Frame = +1 Query: 268 SKLKPEVLEDLKQNTEFSD-AEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKF 444 S+LK L L + ++ +++++ + D +G +S+EE ++ P+ Sbjct: 348 SRLKQFALRALASTLDEAEISDLRDQFDAIDVD-KNGVISLEEMRQALAKDLPWKLKDSR 406 Query: 445 AEHVFRTFDANGDGTIDFREF 507 + D+N DG +DF EF Sbjct: 407 VAEILEAIDSNTDGLVDFTEF 427 >At4g26560.1 68417.m03828 calcineurin B-like protein, putative similar to calcineurin B-like protein 3 [Arabidopsis thaliana] GI:3309086, calcineurin B-like protein 2 [Arabidopsis thaliana] GI:3309084; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 214 Score = 31.9 bits (69), Expect = 0.45 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = +1 Query: 364 CPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREF 507 C G ++ E+F F + S F+E VF FD N DG + F EF Sbjct: 50 CYYGEMNKEQFHVAI--FQTDKNESLFSERVFDLFDTNHDGLLGFEEF 95 Score = 31.5 bits (68), Expect = 0.59 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +3 Query: 495 FQRIPCALSVTS-RGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYQDGG 650 F+ ALSV ++ K+ +F +YDL G+I RQ + ++V A G Sbjct: 92 FEEFARALSVFHPSAPIDDKIDLSFQLYDLKQQGFIERQGVKQLVVATLAASG 144 >At5g17480.1 68418.m02051 polcalcin, putative / calcium-binding pollen allergen, putative similar to polcalcin Bra r 2/Bra n 2 (Calcium-binding pollen allergen Bra r 2/Bra n 2) SP:Q39406 from [Brassica napus] Length = 83 Score = 31.5 bits (68), Expect = 0.59 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = +1 Query: 430 DASKFAEH--VFRTFDANGDGTIDFRE 504 DA++ AEH +F+ FDANGDG I E Sbjct: 3 DATEKAEHDRIFKKFDANGDGKISAAE 29 >At4g35310.1 68417.m05019 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 6 [Arabidopsis thaliana] gi|1399275|gb|AAB03246; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 556 Score = 31.5 bits (68), Expect = 0.59 Identities = 18/55 (32%), Positives = 30/55 (54%) Frame = +1 Query: 343 YKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREF 507 ++ F KD SG ++++E ++ +G A F E + + D N DG ID+ EF Sbjct: 479 FQYFDKD-GSGFITIDELQQAC---VEHGMADVFLEDIIKEVDQNNDGKIDYGEF 529 >At3g03430.1 68416.m00341 polcalcin, putative / calcium-binding pollen allergen, putative almost identical to polcalcin Bra r 2/Bra n 2 (calcium-binding pollen allergen Bra r 2/Bra n 2) SP:Q39406 from [Brassica napus] Length = 83 Score = 31.5 bits (68), Expect = 0.59 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = +1 Query: 430 DASKFAEH--VFRTFDANGDGTIDFRE 504 DA++ AEH +F+ FDANGDG I E Sbjct: 3 DATEKAEHDRIFKKFDANGDGKISAAE 29 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 546 QKLKWAFSMYDLDGNGYISRQEMLEIVTA 632 + +K + D DG+GYIS QE ++ +A Sbjct: 43 EDIKRMMAEIDTDGDGYISYQEFIDFASA 71 >At5g42380.1 68418.m05160 calmodulin-related protein, putative similar to regulator of gene silencing calmodulin-related protein GI:12963415 from [Nicotiana tabacum] Length = 185 Score = 31.1 bits (67), Expect = 0.78 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 433 ASKFAEHVFRTFDANGDGTIDFREF 507 +S+ E V +T D +GDG IDF EF Sbjct: 82 SSREVEEVVKTSDVDGDGFIDFEEF 106 >At2g17890.1 68415.m02072 calcium-dependent protein kinase family protein / CDPK family protein contains Pfam domains, PF00069: Protein kinase domain and PF00036: EF hand Length = 571 Score = 31.1 bits (67), Expect = 0.78 Identities = 20/81 (24%), Positives = 38/81 (46%), Gaps = 1/81 (1%) Frame = +1 Query: 268 SKLKPEVLEDLKQNTEFSD-AEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKF 444 S+LK L L + + A++++ + D +G +S+EE ++ P+ Sbjct: 394 SRLKQFALRALATTLDEEELADLRDQFDAIDVD-KNGVISLEEMRQALAKDHPWKLKDAR 452 Query: 445 AEHVFRTFDANGDGTIDFREF 507 + + D+N DG +DF EF Sbjct: 453 VAEILQAIDSNTDGFVDFGEF 473 Score = 29.9 bits (64), Expect = 1.8 Identities = 10/26 (38%), Positives = 20/26 (76%) Frame = +3 Query: 537 KLEQKLKWAFSMYDLDGNGYISRQEM 614 K +Q+ + AF +D+DG+G+I+ +E+ Sbjct: 490 KWQQRSRAAFEKFDIDGDGFITAEEL 515 >At2g17290.1 68415.m01997 calcium-dependent protein kinase isoform 6 (CPK6) identical to calmodulin-domain protein kinase CDPK isoform 6 [Arabidopsis thaliana] gi|1399275|gb|AAB03246; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 544 Score = 31.1 bits (67), Expect = 0.78 Identities = 16/55 (29%), Positives = 31/55 (56%) Frame = +1 Query: 343 YKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREF 507 ++ F KD SG+++++E ++ + +G F E + + D + DG ID+ EF Sbjct: 467 FQYFDKD-GSGYITIDELQQ---SCIEHGMTDVFLEDIIKEVDQDNDGRIDYEEF 517 >At4g36070.1 68417.m05135 calcium-dependent protein kinase family protein / CDPK family protein contains Pfam domains, PF00069: Protein kinase domain and PF00036: EF hand Length = 536 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +1 Query: 370 SGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFRV 513 +G +S+EE ++ P+ + + D+N DG +DF EF V Sbjct: 388 NGSISLEEMRQALAKDVPWKLKDARVAEILQANDSNTDGLVDFTEFVV 435 Score = 29.5 bits (63), Expect = 2.4 Identities = 10/26 (38%), Positives = 20/26 (76%) Frame = +3 Query: 537 KLEQKLKWAFSMYDLDGNGYISRQEM 614 K +Q+ + AF +D+DG+G+I+ +E+ Sbjct: 450 KWQQRSRAAFDKFDIDGDGFITPEEL 475 >At4g20780.1 68417.m03017 calcium-binding protein, putative similar to SP|Q09011 Calcium-binding protein CAST {Solanum tuberosum}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 191 Score = 30.7 bits (66), Expect = 1.0 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +1 Query: 292 EDLKQNTEFSDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNF-FPYGDASKFAEHVFRTF 468 ED + +++++ E +K F ++ G +S E + + P G + E + + Sbjct: 108 EDDPSSAAENESDLAEAFKVFDEN-GDGFISARELQTVLKKLGLPEGGEMERVEKMIVSV 166 Query: 469 DANGDGTIDFREFR 510 D N DG +DF EF+ Sbjct: 167 DRNQDGRVDFFEFK 180 >At3g03000.1 68416.m00295 calmodulin, putative similar to calmodulin SP:P04352 from [Chlamydomonas reinhardtii]; contains Pfam profile: PF00036 EF hand (4 copies) Length = 165 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 543 EQKLKWAFSMYDLDGNGYISRQEM 614 + +LK F M+D DGNGYI+ E+ Sbjct: 92 DDQLKAIFRMFDRDGNGYITAAEL 115 >At2g38910.1 68415.m04783 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase, isoform AK1 (CDPK) [Arabidopsis thaliana] SWISS-PROT:Q06850; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 583 Score = 30.7 bits (66), Expect = 1.0 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 543 EQKLKWAFSMYDLDGNGYISRQEM 614 E L AFS +D DG+GYI+R E+ Sbjct: 509 EDHLFTAFSYFDQDGSGYITRDEL 532 >At1g32250.1 68414.m03967 calmodulin, putative similar to calmodulin GB:M59770 GI:160127 from (Plasmodium falciparum); contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 166 Score = 30.7 bits (66), Expect = 1.0 Identities = 21/80 (26%), Positives = 40/80 (50%), Gaps = 2/80 (2%) Frame = +1 Query: 274 LKPEVLEDLKQNTEFSDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAE- 450 + PE+L K+ T +++ ++ ++ F D +G ++ E G A AE Sbjct: 77 VSPELLSPAKRTTPYTEEQLLRLFRIFDTD-GNGFITAAELAHSMAKL---GHALTVAEL 132 Query: 451 -HVFRTFDANGDGTIDFREF 507 + + D++GDG I+F+EF Sbjct: 133 TGMIKEADSDGDGRINFQEF 152 >At1g21550.1 68414.m02695 calcium-binding protein, putative contains similarity to calcium-binding protein GB:CAB63264 GI:6580549 from [Lotus japonicus] Length = 155 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/45 (26%), Positives = 29/45 (64%) Frame = +3 Query: 543 EQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYQDGGAPL*RCRKM 677 ++ + AF+++D++G+GYIS +E+ +++ + + A C +M Sbjct: 87 DEAIARAFNVFDVNGDGYISAEELRDVLERLGFEEEAKAWDCGRM 131 >At2g41090.1 68415.m05075 calmodulin-like calcium-binding protein, 22 kDa (CaBP-22) identical to SP|P30187 22 kDa calmodulin-like calcium-binding protein (CABP-22) [Arabidopsis thaliana] Length = 191 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +3 Query: 495 FQRIPCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAI 635 F CA++ + E+ LK F ++D+D NG+IS EM + T + Sbjct: 66 FTEFLCAMAKDTYS--EKDLKKDFRLFDIDKNGFISAAEMRYVRTIL 110 Score = 29.9 bits (64), Expect = 1.8 Identities = 18/61 (29%), Positives = 32/61 (52%) Frame = +1 Query: 325 AEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFRE 504 +E +E + + K+ GH++ EEF + + ++ E + D +GDGTI+F E Sbjct: 11 SEFREQFSVYDKN-GDGHITTEEFGAVMRSLGLNLTQAELQEEI-NDSDLDGDGTINFTE 68 Query: 505 F 507 F Sbjct: 69 F 69 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/64 (21%), Positives = 34/64 (53%) Frame = +1 Query: 316 FSDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTID 495 +S+ ++++ ++ F D +G +S E + + + + + + + D +GDG I+ Sbjct: 78 YSEKDLKKDFRLFDID-KNGFISAAEMRYVR-TILRWKQTDEEIDEIIKAADVDGDGQIN 135 Query: 496 FREF 507 +REF Sbjct: 136 YREF 139 >At1g76650.1 68414.m08919 calcium-binding EF hand family protein similar to regulator of gene silencing calmodulin-related protein GI:12963415 from [Nicotiana tabacum]; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 177 Score = 30.3 bits (65), Expect = 1.4 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = +1 Query: 283 EVLEDLKQNTEFSDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHV-- 456 E+ + N E + E++ + ++ G +S EE +K +F G+ E V Sbjct: 28 EIQQHNSSNGEDKNRELEAVFS-YMDANRDGRISPEELQK---SFMTLGEQLSDEEAVAA 83 Query: 457 FRTFDANGDGTIDFREF 507 R D +GDG +DF EF Sbjct: 84 VRLSDTDGDGMLDFEEF 100 >At1g74740.1 68414.m08660 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604880|dbj|BAA04829; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 541 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 543 EQKLKWAFSMYDLDGNGYISRQEMLEIVT 629 ++ + AF +D DG+GYI +E+ E +T Sbjct: 434 DEHFRQAFMFFDKDGSGYIESEELREALT 462 >At1g05150.1 68414.m00518 calcium-binding EF hand family protein low similarity to O-linked GlcNAc transferase [Homo sapiens] GI:2266994; contains Pfam profiles PF00036: EF hand, PF00515: TPR Domain Length = 808 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/38 (31%), Positives = 24/38 (63%) Frame = +3 Query: 522 VTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAI 635 + +RG +K+K F +D + +G ++R+EM +V A+ Sbjct: 1 MATRGSRSEKVKRIFQQFDGNHDGGLNREEMAALVVAV 38 >At5g44460.1 68418.m05448 calcium-binding protein, putative similar to SP|Q09011 Calcium-binding protein CAST {Solanum tuberosum}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 181 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +3 Query: 534 GKLEQKLKWAFSMYDLDGNGYISRQEMLEIV 626 G E L+ AF+++D DG+G+IS E+ +++ Sbjct: 106 GSPESDLEEAFNVFDEDGDGFISAVELQKVL 136 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +1 Query: 322 DAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNF-FPYGDASKFAEHVFRTFDANGDGTIDF 498 +++++E + F +D G +S E +K+ P + E + + D+N DG +DF Sbjct: 109 ESDLEEAFNVFDED-GDGFISAVELQKVLKKLGLPEAGEIEQVEKMIVSVDSNHDGRVDF 167 Query: 499 REFR 510 EF+ Sbjct: 168 FEFK 171 >At4g09570.1 68417.m01575 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604881|dbj|BAA04830; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 501 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +3 Query: 543 EQKLKWAFSMYDLDGNGYISRQEMLEIVT 629 E+ L AFS +D DG+GYI+ E+ + T Sbjct: 400 EENLVVAFSYFDKDGSGYITIDELQQACT 428 >At2g15680.1 68415.m01795 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 187 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 454 VFRTFDANGDGTIDFREF 507 +F+ D +GDG IDFREF Sbjct: 90 IFKAVDLDGDGFIDFREF 107 >At3g22930.1 68416.m02889 calmodulin, putative strong similarity to calmodulin 8 GI:5825600 from [Arabidopsis thaliana]; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 173 Score = 29.5 bits (63), Expect = 2.4 Identities = 20/91 (21%), Positives = 43/91 (47%), Gaps = 3/91 (3%) Frame = +1 Query: 244 IQNKGKQNSKLKPEVLEDLKQNTEFSDAEIQEWYKGFL---KDCPSGHLSVEEFKKIYGN 414 IQ + +Q + + + + +Q E + +I E+ + F KD G ++ +E + + Sbjct: 4 IQQQQQQQQQQQQQQQQQQQQQQELTQEQIMEFKEAFCLFDKD-GDGCITADELATVIRS 62 Query: 415 FFPYGDASKFAEHVFRTFDANGDGTIDFREF 507 + + + D++G+GTI+F EF Sbjct: 63 L-DQNPTEQELQDMITEIDSDGNGTIEFSEF 92 >At5g39670.1 68418.m04804 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 204 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/44 (27%), Positives = 27/44 (61%) Frame = +3 Query: 546 QKLKWAFSMYDLDGNGYISRQEMLEIVTAIYQDGGAPL*RCRKM 677 +++K AF ++D + +G+I ++ ++T + G+ L CR+M Sbjct: 135 EEVKQAFDVFDENRDGFIDPIDLQRVLTILGLKQGSNLENCRRM 178 >At5g23580.1 68418.m02767 calcium-dependent protein kinase 9 (CDPK9) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836938|gb|AAA67653; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 490 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +1 Query: 352 FLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREF 507 F KD SG++++EE ++ + F G + + + D + DG ID+ EF Sbjct: 407 FDKDA-SGYITIEELQQAWKEF---GINDSNLDEMIKDIDQDNDGQIDYGEF 454 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 543 EQKLKWAFSMYDLDGNGYISRQEM 614 E+ L AFS +D D +GYI+ +E+ Sbjct: 397 EENLVAAFSFFDKDASGYITIEEL 420 >At4g38230.1 68417.m05399 calcium-dependent protein kinase, putative / CDPK, putative calmodulin-domain protein kinase CDPK isoform 6 [Arabidopsis thaliana] gi|1399275|gb|AAB03246; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 340 Score = 29.1 bits (62), Expect = 3.2 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = +1 Query: 343 YKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREF 507 ++ F KD SG+++++E + G + F E V + D + DG ID+ EF Sbjct: 262 FRYFDKD-GSGYITIDELQHACAE---QGMSDVFLEDVIKEVDQDNDGRIDYGEF 312 >At4g38170.1 68417.m05389 far-red impaired responsive protein, putative / SWIM zinc finger family protein similar to far-red impaired response protein [Arabidopsis thaliana] GI:5764395; contains Pfam profile PF04434: SWIM zinc finger Length = 545 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +1 Query: 334 QEWYKGFLKDCPSGHLSVEEFKKIYGNFFP-YGDASKFAEHVFRTFD 471 Q+W + F++D G LS E I +FF + DAS + + + ++ Sbjct: 217 QQWVRVFIRDTFYGELSTNEGSSILNSFFQGFVDASTTMQMLIKQYE 263 >At4g04740.1 68417.m00695 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Lycopersicon esculentum] gi|19171502|emb|CAC87494 Length = 520 Score = 29.1 bits (62), Expect = 3.2 Identities = 18/63 (28%), Positives = 31/63 (49%) Frame = +1 Query: 322 DAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFR 501 D + + ++ KD +GH++ +E + + GD + E V D + DG I+F Sbjct: 443 DEHVHKAFQHLDKD-KNGHITRDELESAMKEY-GMGDEASIKE-VISEVDTDNDGKINFE 499 Query: 502 EFR 510 EFR Sbjct: 500 EFR 502 >At3g03400.1 68416.m00337 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 137 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +1 Query: 373 GHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREF 507 G +S EEF+ P + K E +F D NGDG +D +F Sbjct: 19 GKISWEEFRDAIHALSPSIPSEKLVE-MFIQLDTNGDGQVDAAKF 62 >At2g41410.1 68415.m05110 calmodulin, putative identical to SP|P30188 Calmodulin-like protein {Arabidopsis thaliana} Length = 216 Score = 29.1 bits (62), Expect = 3.2 Identities = 17/60 (28%), Positives = 30/60 (50%) Frame = +1 Query: 328 EIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREF 507 E++E ++ F D +G +S EE +++G + + T D NGDG + F +F Sbjct: 145 ELREVFEIFDVD-RNGKISAEELHRVFGVIGDERCTLEECMRMIATVDGNGDGFVCFDDF 203 >At2g36180.1 68415.m04440 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 144 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 543 EQKLKWAFSMYDLDGNGYISRQEM 614 E +K AF +YD+DG+G IS E+ Sbjct: 74 EVVMKEAFDLYDMDGDGKISASEI 97 >At1g35670.1 68414.m04435 calcium-dependent protein kinase 2 (CDPK2) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604881|dbj|BAA04830; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 495 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 Query: 543 EQKLKWAFSMYDLDGNGYISRQEMLEIVT 629 E+ L AFS +D DG+GYI+ E+ T Sbjct: 401 EENLVAAFSYFDKDGSGYITIDELQSACT 429 >At5g17470.1 68418.m02050 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 146 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +1 Query: 373 GHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREF 507 G +S +EF + F P S+ +++FR D +GD ID E+ Sbjct: 16 GKISWDEFAEAIRAFSP-SITSEEIDNMFREIDVDGDNQIDVAEY 59 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +3 Query: 552 LKWAFSMYDLDGNGYISRQEM 614 +K AF +YD+DG+G IS E+ Sbjct: 78 MKEAFDLYDIDGDGKISASEI 98 >At4g27790.1 68417.m03991 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 345 Score = 28.7 bits (61), Expect = 4.2 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 4/76 (5%) Frame = +1 Query: 292 EDLKQNTEFSDAEIQEWYKGFLKDC--PSGHLSVEEFKK-IYGNFFPYGDASKFAEHVFR 462 +D+++N E E W + F +G L +EEF ++ GD ++ Sbjct: 160 QDIEKN-EKGHGEAGWWMEQFKNSDFDHNGSLDIEEFNNFLHPEDSRNGDTQRWVLKERM 218 Query: 463 T-FDANGDGTIDFREF 507 T D NGDG ++++EF Sbjct: 219 TGMDTNGDGKLEYKEF 234 >At4g18250.1 68417.m02710 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 853 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 166 TNRDSVVLVLIVNSYPKTTSANKAVIIQNKGKQNSKLKP 282 TN V+ +S P TTS++ A + Q K KLKP Sbjct: 425 TNSTDYVITFCPSSIPNTTSSSMAQLPQPKHNSLRKLKP 463 >At2g41100.2 68415.m05077 touch-responsive protein / calmodulin-related protein 3, touch-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] Length = 235 Score = 28.7 bits (61), Expect = 4.2 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +1 Query: 304 QNTEFSDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAE--HVFRTFDAN 477 Q T+ E +E ++ F K+ G+++V E + + G+ AE + DA+ Sbjct: 94 QLTDDQILEFREAFRVFDKN-GDGYITVNELRTTMRSL---GETQTKAELQDMINEADAD 149 Query: 478 GDGTIDFREF 507 GDGTI F EF Sbjct: 150 GDGTISFSEF 159 >At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-related protein 3, touch-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] Length = 324 Score = 28.7 bits (61), Expect = 4.2 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +1 Query: 304 QNTEFSDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAE--HVFRTFDAN 477 Q T+ E +E ++ F K+ G+++V E + + G+ AE + DA+ Sbjct: 183 QLTDDQILEFREAFRVFDKN-GDGYITVNELRTTMRSL---GETQTKAELQDMINEADAD 238 Query: 478 GDGTIDFREF 507 GDGTI F EF Sbjct: 239 GDGTISFSEF 248 Score = 27.5 bits (58), Expect = 9.6 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = +1 Query: 313 EFSDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAE--HVFRTFDANGDG 486 + +D +I E+ + F +G S+ + K++ F G A+ + D +GDG Sbjct: 93 KLTDDQITEYRESFRLFDKNGDGSITK-KELRTVMFSLGKNRTKADLQDMMNEVDLDGDG 151 Query: 487 TIDFREF 507 TIDF EF Sbjct: 152 TIDFPEF 158 >At5g12180.1 68418.m01429 calcium-dependent protein kinase, putative / CDPK, putative Length = 528 Score = 28.3 bits (60), Expect = 5.5 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +1 Query: 331 IQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKF-AEHVFRTFDANGDGTIDFREF 507 ++E +KG D SG +++EE ++ G S++ + + DA+G+GTID+ EF Sbjct: 379 LKEMFKGMDTDS-SGTITLEELRQ--GLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEF 435 >At5g08580.1 68418.m01021 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 391 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 397 KKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREF 507 +K N F Y D + E F DANGDG ++ EF Sbjct: 200 RKSDNNSFGY-DMGWWKEEHFNASDANGDGLLNLTEF 235 >At3g61810.1 68416.m06937 glycosyl hydrolase family 17 protein similar to beta-1,3-glucanase precursor GI:4097948 from [Oryza sativa]; contains Pfam profile PF00332: Glycosyl hydrolases family 17 Length = 375 Score = 28.3 bits (60), Expect = 5.5 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 417 KIPVYLFELFDGKMATGTVLQE 352 K+PVY+F LFD TG +++ Sbjct: 333 KVPVYIFALFDEDQKTGNAVEK 354 >At3g51920.1 68416.m05695 calmodulin-9 (CAM9) identical to calmodulin 9 GI:5825602 from [Arabidopsis thaliana]; contains Pfam profile PF00036: EF hand Length = 151 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 445 AEHVFRTFDANGDGTIDFREF 507 AEH+ R D +GDG + F EF Sbjct: 122 AEHMVREADLDGDGFLSFHEF 142 Score = 27.5 bits (58), Expect = 9.6 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = +1 Query: 316 FSDAEIQEWYKGF-LKDCPS-GHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGT 489 F+D +IQE+Y+ F L D S G ++ E+ K+ + A + + + D G+G Sbjct: 5 FTDEQIQEFYEAFCLIDKDSDGFITKEKLTKVMKSMGKNPKAEQL-QQMMSDVDIFGNGG 63 Query: 490 IDFREF 507 I F +F Sbjct: 64 ITFDDF 69 >At3g50770.1 68416.m05560 calmodulin-related protein, putative similar to regulator of gene silencing calmodulin-related protein GI:12963415 from [Nicotiana tabacum] Length = 205 Score = 28.3 bits (60), Expect = 5.5 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 3/66 (4%) Frame = +1 Query: 322 DAEIQEWYKGFLKDCPSGHLSVEEFKKIY---GNFFPYGDASKFAEHVFRTFDANGDGTI 492 D E++ ++ F + SG ++ + +K+ G YG+ E + + +D +G+G + Sbjct: 139 DGELKTAFEMFEVEKGSGCITPKGLQKMLVKLGESRTYGEC----EAMIKFYDIDGNGIL 194 Query: 493 DFREFR 510 DF EFR Sbjct: 195 DFHEFR 200 >At3g03410.1 68416.m00339 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 131 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +1 Query: 373 GHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREF 507 G LS++EF+++ F PY + F D +G+G ++ EF Sbjct: 16 GKLSLDEFREVALAFSPYFTQEDIVK-FFEEIDVDGNGELNADEF 59 >At2g45670.1 68415.m05678 calcineurin B subunit-related contains Pfam PF00036: EF hand domain and Prosite PS00018: EF-hand calcium-binding domain; contains Pfam profile PF01553: Acyltransferase; weak similarity to Calcineurin B subunit isoform 2 (Protein phosphatase 2B regulatory subunit 2) (Protein phosphatase 3 regulatory subunit B alpha isoform 2) (Swiss-Prot:Q63811) [Mus musculus] Length = 539 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 522 VTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLE 620 V ++ +Q + AFS D DG+GYI+ QE+ E Sbjct: 452 VLTQPLFKQTCELAFSHCDADGDGYITIQELGE 484 >At1g61950.1 68414.m06988 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase GI:3283996 from [Nicotiana tabacum]; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 551 Score = 28.3 bits (60), Expect = 5.5 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 531 RGKLEQKLKWAFSMYDLDGNGYISRQEM 614 R + E L AF +D D +G+ISRQE+ Sbjct: 470 RVEREDNLFKAFQHFDKDNSGFISRQEL 497 >At5g37780.1 68418.m04549 calmodulin-1/4 (CAM1) identical to calmodulin 4 [Arabidopsis thaliana] GI:16223, SP|P25854 Calmodulin-1/4 {Arabidopsis thaliana} Length = 149 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/32 (34%), Positives = 23/32 (71%) Frame = +3 Query: 549 KLKWAFSMYDLDGNGYISRQEMLEIVTAIYQD 644 + K AFS++D DG+G I+ +E+ ++ ++ Q+ Sbjct: 12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQN 43 >At5g21274.1 68418.m02533 calmodulin-6 (CAM6) identical to calmodulin-6 SP:Q03509 from [Arabidopsis thaliana]; contains Pfam profile: PF00036 EF hand Length = 149 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/32 (34%), Positives = 23/32 (71%) Frame = +3 Query: 549 KLKWAFSMYDLDGNGYISRQEMLEIVTAIYQD 644 + K AFS++D DG+G I+ +E+ ++ ++ Q+ Sbjct: 12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQN 43 >At5g19360.1 68418.m02307 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Marchantia polymorpha] gi|5162877|dbj|BAA81748 Length = 523 Score = 27.9 bits (59), Expect = 7.3 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +1 Query: 331 IQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKF-AEHVFRTFDANGDGTIDFREF 507 ++E +KG D SG +++EE ++ G S++ + + DA+G+GTID+ EF Sbjct: 374 LKEMFKGMDTD-NSGTITLEELRQ--GLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEF 430 >At3g56800.1 68416.m06317 calmodulin-2/3/5 (CAM3) identical to calmodulin GI:474183 from [Arabidopsis thaliana]; almost identical to calmodulin-2/3/5 SP:P25069 [Arabidopsis thaliana] Length = 149 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/32 (34%), Positives = 23/32 (71%) Frame = +3 Query: 549 KLKWAFSMYDLDGNGYISRQEMLEIVTAIYQD 644 + K AFS++D DG+G I+ +E+ ++ ++ Q+ Sbjct: 12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQN 43 >At3g43810.1 68416.m04682 calmodulin-7 (CAM7) almost identical to calmodulin GI:16227 from [Arabidopsis thaliana], SP|P59220 Calmodulin-7 {Arabidopsis thaliana} Length = 149 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/32 (34%), Positives = 23/32 (71%) Frame = +3 Query: 549 KLKWAFSMYDLDGNGYISRQEMLEIVTAIYQD 644 + K AFS++D DG+G I+ +E+ ++ ++ Q+ Sbjct: 12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQN 43 >At2g41110.1 68415.m05078 calmodulin-2/3/5 (CAM2) (CAL1) almost identical to Calmodulin-2/3/5 SP:P25069 from [Arabidopsis thaliana] Length = 149 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/32 (34%), Positives = 23/32 (71%) Frame = +3 Query: 549 KLKWAFSMYDLDGNGYISRQEMLEIVTAIYQD 644 + K AFS++D DG+G I+ +E+ ++ ++ Q+ Sbjct: 12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQN 43 >At2g27030.3 68415.m03247 calmodulin-2/3/5 (CAM5) (TCH1) identical to calmodulin GI:474183 from [Arabidopsis thaliana], SP|P25069 Calmodulin-2/3/5 {Arabidopsis thaliana} Length = 181 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/32 (34%), Positives = 23/32 (71%) Frame = +3 Query: 549 KLKWAFSMYDLDGNGYISRQEMLEIVTAIYQD 644 + K AFS++D DG+G I+ +E+ ++ ++ Q+ Sbjct: 12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQN 43 >At2g27030.1 68415.m03245 calmodulin-2/3/5 (CAM5) (TCH1) identical to calmodulin GI:474183 from [Arabidopsis thaliana], SP|P25069 Calmodulin-2/3/5 {Arabidopsis thaliana} Length = 149 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/32 (34%), Positives = 23/32 (71%) Frame = +3 Query: 549 KLKWAFSMYDLDGNGYISRQEMLEIVTAIYQD 644 + K AFS++D DG+G I+ +E+ ++ ++ Q+ Sbjct: 12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQN 43 >At1g66410.1 68414.m07542 calmodulin-1/4 (CAM4) identical to calmodulin [Arabidopsis thaliana] GI:16223; nearly identical to SP|P25854 Calmodulin-1/4 {Arabidopsis thaliana} Length = 149 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/32 (34%), Positives = 23/32 (71%) Frame = +3 Query: 549 KLKWAFSMYDLDGNGYISRQEMLEIVTAIYQD 644 + K AFS++D DG+G I+ +E+ ++ ++ Q+ Sbjct: 12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQN 43 >At1g03960.2 68414.m00382 calcium-binding EF hand family protein contains Pfam profile: PF00036 EF hand Length = 389 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 543 EQKLKWAFSMYDLDGNGYISRQEM 614 E L++ F DLDGNG I+ EM Sbjct: 243 EPSLEYWFKCVDLDGNGVITSNEM 266 >At1g03960.1 68414.m00381 calcium-binding EF hand family protein contains Pfam profile: PF00036 EF hand Length = 529 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 543 EQKLKWAFSMYDLDGNGYISRQEM 614 E L++ F DLDGNG I+ EM Sbjct: 383 EPSLEYWFKCVDLDGNGVITSNEM 406 >At3g28850.1 68416.m03599 glutaredoxin family protein Length = 428 Score = 27.5 bits (58), Expect = 9.6 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +1 Query: 250 NKGKQNSKLKPEVL--EDLKQNTEFSDAEIQEWYKGFLKDCPSGH 378 N GK N +KP L E+ ++ E D EI ++ L++ PS H Sbjct: 175 NGGKSNGSVKPVWLQMEEEEEGFEDFDPEIISSFRKSLQELPSDH 219 >At3g24110.1 68416.m03027 calcium-binding EF hand family protein contains Pfam profile: PF00036 EF hand, similar to calcium-modulated proteins Length = 229 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = +1 Query: 373 GHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFR 510 GH S++ I F + + VF ++D + +GTID E + Sbjct: 34 GHRSLKSMDSIIMKFPKLREGLRNIRSVFESYDNDTNGTIDIEELK 79 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,222,647 Number of Sequences: 28952 Number of extensions: 394295 Number of successful extensions: 1363 Number of sequences better than 10.0: 85 Number of HSP's better than 10.0 without gapping: 1181 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1359 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -