BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0790 (757 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2424| Best HMM Match : RVT_1 (HMM E-Value=6.2e-18) 36 0.047 SB_57968| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.082 SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25) 35 0.082 SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) 34 0.11 SB_58071| Best HMM Match : Death (HMM E-Value=8.4e-12) 33 0.25 SB_11166| Best HMM Match : CARD (HMM E-Value=0.001) 29 3.1 SB_59480| Best HMM Match : ZU5 (HMM E-Value=2.4e-38) 29 4.1 SB_12910| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_59267| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_29188| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 SB_13776| Best HMM Match : Plasmid_killer (HMM E-Value=4) 28 9.4 SB_6869| Best HMM Match : Peptidase_A17 (HMM E-Value=2.8026e-45) 28 9.4 SB_39228| Best HMM Match : IBR (HMM E-Value=4.1e-20) 28 9.4 SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) 28 9.4 >SB_2424| Best HMM Match : RVT_1 (HMM E-Value=6.2e-18) Length = 657 Score = 35.5 bits (78), Expect = 0.047 Identities = 22/72 (30%), Positives = 38/72 (52%) Frame = +3 Query: 477 LENHSEESGGFPNCWRDVGHLLGVTQDDLNYIMNSLKDDPVDMVLKVFRQNEKATINKIV 656 L N+S ESG FP+CW++ + + + L I +L+ PV + V + E+A N+ Sbjct: 202 LINNSLESGIFPDCWKEATVVPLLKKQGLESIFKNLR--PVSNLAYVSKLIERAVFNQTD 259 Query: 657 DAFIKLQRYDIL 692 + I+ Y +L Sbjct: 260 NHLIQSALYPLL 271 >SB_57968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 34.7 bits (76), Expect = 0.082 Identities = 22/72 (30%), Positives = 38/72 (52%) Frame = +3 Query: 477 LENHSEESGGFPNCWRDVGHLLGVTQDDLNYIMNSLKDDPVDMVLKVFRQNEKATINKIV 656 L N+S ESG FP+CW++ + + + L I +L+ PV + V + E+A N+ Sbjct: 142 LINNSLESGIFPDCWKEAIVVPLLKKQGLESIFKNLR--PVSNLAYVSKLIERAVFNQTD 199 Query: 657 DAFIKLQRYDIL 692 + I+ Y +L Sbjct: 200 NHLIQSALYPLL 211 >SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25) Length = 1486 Score = 34.7 bits (76), Expect = 0.082 Identities = 22/72 (30%), Positives = 38/72 (52%) Frame = +3 Query: 477 LENHSEESGGFPNCWRDVGHLLGVTQDDLNYIMNSLKDDPVDMVLKVFRQNEKATINKIV 656 L N+S ESG FP+CW++ + + + L I +L+ PV + V + E+A N+ Sbjct: 524 LINNSLESGIFPDCWKEAIVVPLLKKQGLESIFKNLR--PVSNLAYVSKLIERAVFNQTD 581 Query: 657 DAFIKLQRYDIL 692 + I+ Y +L Sbjct: 582 NHLIQSALYPLL 593 >SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) Length = 799 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +3 Query: 513 NCWRDVGHLLGVTQDDLNYIMNSLKDDPVDMVLK-VFRQNEKATINKIVDAFIKLQRYDI 689 NCWR V L + Q N +KD+P +L V + + T+ + + ++R D+ Sbjct: 603 NCWRTVATQLDIPQRVFEQFDNKMKDNPTRQLLHLVHTHDTRLTVEDLKTKLMSIEREDV 662 Query: 690 L 692 + Sbjct: 663 V 663 >SB_58071| Best HMM Match : Death (HMM E-Value=8.4e-12) Length = 633 Score = 33.1 bits (72), Expect = 0.25 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Frame = +3 Query: 495 ESGGFPNCWRDVGHLLGVTQDDLNYIMNSLKDDPV-DMVLKVFRQNEKATINKIVDAFIK 671 + GG P CWRD+ +L + + + + + P DM++ + + TI+ + D Sbjct: 325 QHGGVP-CWRDLAEVLAIPPEAYEHCSSFSETSPTEDMMMFLSATKPQLTISDMKDGLRA 383 Query: 672 LQRYDIL 692 + R D+L Sbjct: 384 IGRQDVL 390 >SB_11166| Best HMM Match : CARD (HMM E-Value=0.001) Length = 720 Score = 29.5 bits (63), Expect = 3.1 Identities = 27/96 (28%), Positives = 51/96 (53%) Frame = +3 Query: 414 HTDLLYYRNIKSKMGAAWL*SLENHSEESGGFPNCWRDVGHLLGVTQDDLNYIMNSLKDD 593 HT+ L +NI S + + +L N E G N WR V +G+T ++++ + +S K D Sbjct: 102 HTETLL-KNIPSSLRDTIVQTL-NIKTELG---NNWRGVAGHMGLTSEEVDRLDDSGKMD 156 Query: 594 PVDMVLKVFRQNEKATINKIVDAFIKLQRYDILLAI 701 + ++ +N K + IVD + +R+D++ +I Sbjct: 157 --SLFAQMVHKNYK--LQDIVDLLKECERHDVVESI 188 >SB_59480| Best HMM Match : ZU5 (HMM E-Value=2.4e-38) Length = 903 Score = 29.1 bits (62), Expect = 4.1 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 3/44 (6%) Frame = +3 Query: 513 NCWRDVGHLLGVTQDDLNYI---MNSLKDDPVDMVLKVFRQNEK 635 N W+ VG LG T+++LN I + + D+ + VL V+R +++ Sbjct: 702 NDWQAVGKQLGFTEEELNEISENKSGVPDECAEEVLTVWRDSKE 745 >SB_12910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 Query: 375 NRLNYLSKKVDYLHTDLLYYRNIKSKMG 458 NRLN L KK+D+ L+ N K KMG Sbjct: 7 NRLNSLKKKLDHKVDKLIQAENEKKKMG 34 >SB_59267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1444 Score = 28.7 bits (61), Expect = 5.4 Identities = 20/110 (18%), Positives = 56/110 (50%), Gaps = 2/110 (1%) Frame = +3 Query: 414 HTDLLY-YRNIKSKMGAAWL*SLENHSEESGGFPNCWRDVGHLLGVTQDDLNYIMNSLKD 590 H++L++ Y + ++ G S+E+H + + D+ +D+L +++ Sbjct: 780 HSNLMHQYEAVAAENGKKI--SMEDHVIALDEWRSLLEDLKVKKTSEEDELKSHQEAIQK 837 Query: 591 DPVDMVLKVFRQNEKAT-INKIVDAFIKLQRYDILLAIGKSTVDYGLXIL 737 + ++ +++ + T + + ++A+ K Q+YDI+ + + + DY + +L Sbjct: 838 EKNNLAVELADFKARVTQLERELEAYKKSQKYDIIFLLPEDSKDYNIDLL 887 >SB_29188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 28.7 bits (61), Expect = 5.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 273 NVKMEYLCEHLDETASVDTLQLEEFLREQRAAEINRL 383 +V + + E E +S+D L E LRE RA EI L Sbjct: 417 SVALTSMRERTVEVSSIDITSLNETLREDRAIEITSL 453 >SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3038 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/37 (29%), Positives = 25/37 (67%) Frame = +3 Query: 303 LDETASVDTLQLEEFLREQRAAEINRLNYLSKKVDYL 413 L+ TA+V +++L + +RE+ ++N++NY + + L Sbjct: 1318 LELTAAVISVKLSKIIREELDLKVNKVNYWTDSMSVL 1354 >SB_13776| Best HMM Match : Plasmid_killer (HMM E-Value=4) Length = 316 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/37 (29%), Positives = 25/37 (67%) Frame = +3 Query: 303 LDETASVDTLQLEEFLREQRAAEINRLNYLSKKVDYL 413 L+ TA+V +++L + +RE+ ++N++NY + + L Sbjct: 17 LELTAAVISVKLSKIIREELDLKVNKVNYWTDSMSVL 53 >SB_6869| Best HMM Match : Peptidase_A17 (HMM E-Value=2.8026e-45) Length = 811 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/37 (29%), Positives = 25/37 (67%) Frame = +3 Query: 303 LDETASVDTLQLEEFLREQRAAEINRLNYLSKKVDYL 413 L+ TA+V +++L + +RE+ ++N++NY + + L Sbjct: 228 LELTAAVISVKLSKIIREELDLKVNKVNYWTDSMSVL 264 >SB_39228| Best HMM Match : IBR (HMM E-Value=4.1e-20) Length = 303 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 171 VTRNVRLTETFMNFLFYQSIYKFSTLQRC 85 V + +L E F+NFLF I FS L+ C Sbjct: 63 VLKGGKLREKFINFLFNDQIKTFSKLRWC 91 >SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1478 Score = 27.9 bits (59), Expect = 9.4 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 8/72 (11%) Frame = -2 Query: 594 GHLLKNSLCNLGHPV*H-------LINGQHLSNNL-ETPHFLHYGFPDFIARQHPF*I*Y 439 GH +KN C L + L+ G L NNL E L++ PD + F + Sbjct: 948 GHRIKNLNCRLIRELKSYNSANRLLLTGTPLQNNLAELWSLLNFLLPDIFDDLNSFQRWF 1007 Query: 438 FYSTINQYGGNQ 403 +S IN GGN+ Sbjct: 1008 DFSAINDEGGNE 1019 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,781,134 Number of Sequences: 59808 Number of extensions: 405764 Number of successful extensions: 910 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 909 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -