BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0789 (740 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 87 5e-19 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 25 3.2 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 5.7 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 24 5.7 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 24 5.7 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 23 7.5 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 7.5 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 7.5 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 23 9.9 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 23 9.9 AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 prot... 23 9.9 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 87.0 bits (206), Expect = 5e-19 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = +3 Query: 3 LNVLRIINEPTAAAIAYGLDKKGTGERNVLIFXLGGGTFDVSILTIEDG 149 LNV+RIINEPTAAA+AYGLDK GERNVLIF LGGGTFDVSILTI++G Sbjct: 27 LNVMRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEG 75 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 24.6 bits (51), Expect = 3.2 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +1 Query: 193 VRTLTIAWSTTLSRSSRGNTKGPRYQQES 279 VR T+ W L++ + N + +YQ +S Sbjct: 90 VRMPTLTWDEELAKQAGNNARSCQYQHDS 118 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 527 RVEPPTIQYRGFEPYPSWHHGE 462 R+ I Y GFEPY H G+ Sbjct: 1329 RLVDEMISYYGFEPYERNHFGK 1350 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.8 bits (49), Expect = 5.7 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -2 Query: 184 WVSPAVDFTSKIPSSMVRMDTSKVPPPRXKIST 86 W+ P T+ +P++ PPP +T Sbjct: 221 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 253 Score = 23.4 bits (48), Expect = 7.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +1 Query: 172 PATPTWEVRTLTIAWSTTLSRSSRGNTKGP 261 PAT T T T W TT + + T+ P Sbjct: 103 PATTTLRPTTTTTDWITTTTTEATTTTRFP 132 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 5.7 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -2 Query: 184 WVSPAVDFTSKIPSSMVRMDTSKVPPPRXKIST 86 W+ P T+ +P++ PPP +T Sbjct: 222 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 254 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.4 bits (48), Expect = 7.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +1 Query: 172 PATPTWEVRTLTIAWSTTLSRSSRGNTKGP 261 PAT T T T W TT + + T+ P Sbjct: 103 PATTTLRPTTTTTDWITTTTTEATTTTRFP 132 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.4 bits (48), Expect = 7.5 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -2 Query: 160 TSKIPSSMVRMDTSKVPPPRXKISTFRSPVPFLS-RP*AIAAA 35 T+K+ + M T+ PPP ++ +P P + +P + AAA Sbjct: 572 TTKLSTMMTTTTTTTEPPPIVQVIGLPAPTPRNNYKPSSAAAA 614 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.4 bits (48), Expect = 7.5 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -2 Query: 160 TSKIPSSMVRMDTSKVPPPRXKISTFRSPVPFLS-RP*AIAAA 35 T+K+ + M T+ PPP ++ +P P + +P + AAA Sbjct: 571 TTKLSTMMTTTTTTTEPPPIVQVIGLPAPTPRNNYKPSSAAAA 613 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 9.9 Identities = 8/33 (24%), Positives = 13/33 (39%) Frame = -2 Query: 184 WVSPAVDFTSKIPSSMVRMDTSKVPPPRXKIST 86 W+ P T+ P++ PPP +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDQPPPPPTTTTTT 254 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 9.9 Identities = 8/33 (24%), Positives = 13/33 (39%) Frame = -2 Query: 184 WVSPAVDFTSKIPSSMVRMDTSKVPPPRXKIST 86 W+ P T+ +P + PPP +T Sbjct: 222 WIDPTATTTTHVPPTTTTWSDLPPPPPTTTTTT 254 >AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 protein. Length = 128 Score = 23.0 bits (47), Expect = 9.9 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +2 Query: 449 PVEKSLRDAKMDKAQIHDIVWWVAPLV 529 PV+K D KMD+ + + W+ PL+ Sbjct: 88 PVKKE-PDWKMDQQDDNQLKQWIVPLI 113 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 786,763 Number of Sequences: 2352 Number of extensions: 16361 Number of successful extensions: 46 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -