BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0786 (764 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25G10.07c |cut7||kinesin-like protein Cut7|Schizosaccharomyc... 27 3.9 SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 27 3.9 >SPAC25G10.07c |cut7||kinesin-like protein Cut7|Schizosaccharomyces pombe|chr 1|||Manual Length = 1085 Score = 26.6 bits (56), Expect = 3.9 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = -2 Query: 310 NSVFV*S*TYKLLFLGRLCYFQNQDATCEMGARWRNKIS*NVRPRLNQLHCASKS 146 N V++ TYK L + R+ QN+D C+ AR + NV+ QL SKS Sbjct: 458 NGVYLAESTYKEL-MDRV---QNKDLLCQEQARKLEVLDLNVKSSREQLQYVSKS 508 >SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1367 Score = 26.6 bits (56), Expect = 3.9 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +2 Query: 647 FLFLIAYVRALTRFWRAFGPIYVXAKTLSQTCLQPVYWC 763 ++F I T + GP Y K+ S+TC +WC Sbjct: 1247 WMFSIGVFWIWTFIYSEVGPSYAFHKSASRTCQTFGFWC 1285 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,949,388 Number of Sequences: 5004 Number of extensions: 57188 Number of successful extensions: 152 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 152 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 367316502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -