BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0786 (764 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31412| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_54232| Best HMM Match : Pkinase (HMM E-Value=1.1e-39) 29 3.1 >SB_31412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 909 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 199 FCSANAHPFHKWRPDSENSIISQETVICK 285 FC NA KWRP +E S+ S + CK Sbjct: 816 FCLNNATQNTKWRPITERSVFSAMSTACK 844 >SB_54232| Best HMM Match : Pkinase (HMM E-Value=1.1e-39) Length = 1123 Score = 29.5 bits (63), Expect = 3.1 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 24 VDVLAKGQSGSVWIVENAQPAREWRG*V*IGKAFRNIERHLDL 152 +D++ KG GS W+VE+ Q R + A + +RHL L Sbjct: 7 IDIIGKGTFGSAWLVESRQSKRLYALKELNATAMPSEDRHLAL 49 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,546,506 Number of Sequences: 59808 Number of extensions: 412073 Number of successful extensions: 698 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 698 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -