BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0783 (830 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11841| Best HMM Match : Ras (HMM E-Value=0) 29 3.5 SB_26360| Best HMM Match : PKD_channel (HMM E-Value=1.3e-30) 29 6.1 SB_53578| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_11841| Best HMM Match : Ras (HMM E-Value=0) Length = 523 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = -1 Query: 461 KNYLCAYLTDNNKSTEPLQIIREQWQAQGSVETVPLGSVQSNQTNSADKSTVPDDA 294 + +LC + +N+KS E + REQ + E VP+ V N+ + ++ DA Sbjct: 302 EGFLCVFAVNNSKSFEDINQYREQIKRVKDAEEVPMVLV-GNKCDLPQRTVSTSDA 356 >SB_26360| Best HMM Match : PKD_channel (HMM E-Value=1.3e-30) Length = 3015 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/73 (23%), Positives = 34/73 (46%) Frame = -3 Query: 522 VTRANLNTST*TCKRIVTLLKKLPLCLFNRQQQIY*TTTNHQGTVASARKCGNCATGLSP 343 +T A++NT+ T +VT++ + C + Q T+ + + R+ +C + P Sbjct: 1184 ITTAHINTTITTAHIVVTIITIIMACSYFIGLQYVKTSRTRRSCFGNGRQKRSC---IEP 1240 Query: 342 KQPNKLSRQVNCP 304 K P +L + P Sbjct: 1241 KDPPQLGNRTVMP 1253 >SB_53578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -3 Query: 549 LRSKRNSWVVTRANLNTST*TCKRIVTLLKKLPLCLF 439 ++ + N+W V TST T KR+ LKK + LF Sbjct: 1226 IKRQNNTWQVETKEHETSTTTTKRLQKSLKKAKIKLF 1262 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,585,722 Number of Sequences: 59808 Number of extensions: 516210 Number of successful extensions: 1095 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1015 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1095 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2335516755 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -