BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0783 (830 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125956-8|AAD14728.2| 678|Caenorhabditis elegans Hypothetical ... 32 0.44 AF125956-7|AAX55694.1| 657|Caenorhabditis elegans Hypothetical ... 32 0.44 >AF125956-8|AAD14728.2| 678|Caenorhabditis elegans Hypothetical protein DC2.7a protein. Length = 678 Score = 32.3 bits (70), Expect = 0.44 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -1 Query: 452 LCAYLTDNNKSTEPLQII-REQWQAQGSVETVPLGSVQSNQTNSADKST 309 LC+ L N P+++I ++ W G ETV + S S NS KS+ Sbjct: 599 LCSILAHNPTHRAPIELIEQDHWFQFGDEETVEITSASSTSCNSEAKSS 647 >AF125956-7|AAX55694.1| 657|Caenorhabditis elegans Hypothetical protein DC2.7c protein. Length = 657 Score = 32.3 bits (70), Expect = 0.44 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -1 Query: 452 LCAYLTDNNKSTEPLQII-REQWQAQGSVETVPLGSVQSNQTNSADKST 309 LC+ L N P+++I ++ W G ETV + S S NS KS+ Sbjct: 569 LCSILAHNPTHRAPIELIEQDHWFQFGDEETVEITSASSTSCNSEAKSS 617 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,076,126 Number of Sequences: 27780 Number of extensions: 395222 Number of successful extensions: 840 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 840 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2061488408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -