BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0781 (834 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1341 - 32768785-32768847,32770469-32770582,32770809-327708... 30 2.0 04_01_0009 - 178579-178638,179151-179246,179504-179565,180181-18... 28 8.0 >04_04_1341 - 32768785-32768847,32770469-32770582,32770809-32770858, 32770940-32771033,32771144-32771221,32771397-32771472, 32771557-32771651,32771748-32771927,32772491-32772802, 32773122-32773670 Length = 536 Score = 30.3 bits (65), Expect = 2.0 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 4/78 (5%) Frame = +3 Query: 33 DEKYQQYLKHREDLENVFKNILGDDGVFLYPSHPTTA----PYHNEPLVKAFNFSYTAII 200 D Y++ + R ++ FK L + + P+ P+ A N+PL + T + Sbjct: 422 DAYYKRAQQVRTLVKKSFKEALERYDILVSPAAPSAAYKIGEKINDPLAMYAGDTMTVNV 481 Query: 201 NSLGLPATTIPLGLGRDG 254 N GLPA +P G G Sbjct: 482 NLAGLPALVVPCGFVEGG 499 >04_01_0009 - 178579-178638,179151-179246,179504-179565,180181-180245, 181271-181363,181489-181592,182070-182153,182223-182303, 182829-182880,183048-183119,183411-183486,183568-183680, 184056-184203,184295-184372,184511-184640,184733-184923, 187039-187099,187201-187371 Length = 578 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +3 Query: 162 LVKAFNFSYTAIINSLGLPATTIPLGLGRDGYLLVCKLL 278 +V A+ + N LGLPA T+P+G + G + +L+ Sbjct: 504 VVSAYLMRFVIAGNLLGLPAITVPVGHDKQGLPIGLQLI 542 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,491,001 Number of Sequences: 37544 Number of extensions: 433354 Number of successful extensions: 1039 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1005 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1039 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2303447664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -