BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0781 (834 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 24 2.0 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 24 2.0 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 24 2.0 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 24 2.0 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 24 2.0 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 24 2.0 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 24 2.0 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 24 2.0 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 23 2.6 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 4.6 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 4.6 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 6.1 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 6.1 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 6.1 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 22 6.1 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 6.1 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 22 8.0 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 2.0 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 829 LKRDYGRGLHPVVERYRLMIIVNHKHRYYYHSVCL 725 LKR G G P+ ER + I+N + H L Sbjct: 159 LKRRTGEGSKPIFEREEIKNILNKTNEITEHRTVL 193 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 2.0 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 829 LKRDYGRGLHPVVERYRLMIIVNHKHRYYYHSVCL 725 LKR G G P+ ER + I+N + H L Sbjct: 159 LKRRTGEGSKPIFEREEIKNILNKTNEITEHRTVL 193 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 2.0 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 829 LKRDYGRGLHPVVERYRLMIIVNHKHRYYYHSVCL 725 LKR G G P+ ER + I+N + H L Sbjct: 159 LKRRTGEGSKPIFEREEIKNILNKTNEITEHRTVL 193 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 2.0 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 829 LKRDYGRGLHPVVERYRLMIIVNHKHRYYYHSVCL 725 LKR G G P+ ER + I+N + H L Sbjct: 159 LKRRTGEGSKPIFEREEIKNILNKTNEITEHRTVL 193 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 2.0 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 829 LKRDYGRGLHPVVERYRLMIIVNHKHRYYYHSVCL 725 LKR G G P+ ER + I+N + H L Sbjct: 159 LKRRTGEGSKPIFEREEIKNILNKTNEITEHRTVL 193 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 2.0 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 829 LKRDYGRGLHPVVERYRLMIIVNHKHRYYYHSVCL 725 LKR G G P+ ER + I+N + H L Sbjct: 159 LKRRTGEGSKPIFEREEIKNILNKTNEITEHRTVL 193 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 23.8 bits (49), Expect = 2.0 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 829 LKRDYGRGLHPVVERYRLMIIVNHKHRYYYHSVCL 725 LKR G G P+ ER + I+N + H L Sbjct: 159 LKRRTGEGSKPIFEREEIKNILNKTNEITEHRTVL 193 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 23.8 bits (49), Expect = 2.0 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 829 LKRDYGRGLHPVVERYRLMIIVNHKHRYYYHSVCL 725 LKR G G P+ ER + I+N + H L Sbjct: 159 LKRRTGEGSKPIFEREEIKNILNKTNEITEHRTVL 193 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.4 bits (48), Expect = 2.6 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 160 GSL-WYGAVVGCDGYKKTPSSPR 95 GSL YG+ GCD KK +PR Sbjct: 159 GSLNGYGSSDGCDARKKKGPTPR 181 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.6 bits (46), Expect = 4.6 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 799 PVVERYRLMIIVNHKHRYYYHSV 731 PV E Y+ + + K YY H V Sbjct: 445 PVNENYKSLNLAAQKREYYSHYV 467 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 22.6 bits (46), Expect = 4.6 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -3 Query: 421 KKFPTYLLISGNITLT*NLRSL 356 KK P Y L N+TL SL Sbjct: 599 KKMPRYCLFGHNVTLANKFESL 620 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 22.2 bits (45), Expect = 6.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 619 IYHNAYSYFHRLLIELF 569 +YHN+ FHRL F Sbjct: 215 VYHNSDDSFHRLTSNTF 231 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.2 bits (45), Expect = 6.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 619 IYHNAYSYFHRLLIELF 569 +YHN+ FHRL F Sbjct: 215 VYHNSDDSFHRLTSNTF 231 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.2 bits (45), Expect = 6.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 619 IYHNAYSYFHRLLIELF 569 +YHN+ FHRL F Sbjct: 215 VYHNSDDSFHRLTSNTF 231 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 22.2 bits (45), Expect = 6.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -2 Query: 407 LFINFRKHNANLKLKIFVALSNRRKLY 327 L INF K+N + + V N K+Y Sbjct: 505 LLINFSKNNTIVDISKLVNKRNNAKIY 531 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 22.2 bits (45), Expect = 6.1 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 656 LSKVYPYYRELLHLSQC 606 LS PY+RELL + C Sbjct: 50 LSACSPYFRELLKSTPC 66 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 21.8 bits (44), Expect = 8.0 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 423 YCYRMTTNEP 452 YCY +T N+P Sbjct: 220 YCYNLTPNQP 229 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 235,999 Number of Sequences: 438 Number of extensions: 5563 Number of successful extensions: 25 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26702940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -