BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0778 (756 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_05_0043 + 8503979-8504407,8506484-8506624,8506865-8506975,850... 32 0.43 08_02_0854 - 21905054-21906308,21906396-21907300 30 1.7 07_01_0162 + 1138420-1138640,1138788-1138830,1139449-1140971,114... 28 7.0 >10_05_0043 + 8503979-8504407,8506484-8506624,8506865-8506975, 8507746-8508330 Length = 421 Score = 32.3 bits (70), Expect = 0.43 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 334 IEPEYCGVCALELDSFGMSRLHYLSKNHAKNLRK 435 ++P C VC ++ D+ + R+H K H KNL + Sbjct: 275 VQPLTCEVCKIQCDTPEVLRIHKTGKKHKKNLER 308 >08_02_0854 - 21905054-21906308,21906396-21907300 Length = 719 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -1 Query: 534 TYKVDKTSMKHYIVKLSIYLFLIRSTIIRFRHPFSQI 424 T++ K + KHY + IYL I + ++ H FS++ Sbjct: 591 THRRHKVTNKHYYHVVEIYLAAIDAILVEMNHSFSEV 627 >07_01_0162 + 1138420-1138640,1138788-1138830,1139449-1140971, 1141770-1142063,1142145-1142337,1142624-1142694, 1142781-1144200 Length = 1254 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -3 Query: 193 LIG*RPKHWSWS-WSKHEVRRGSWWMI 116 + G RP HW S + RRG WW++ Sbjct: 545 MAGCRPTHWPRSALVRQRRRRGGWWLV 571 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,766,778 Number of Sequences: 37544 Number of extensions: 389271 Number of successful extensions: 917 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 889 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 915 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -