BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0778 (756 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g24450.1 68414.m03080 ribonuclease III family protein contain... 33 0.20 At1g19030.1 68414.m02369 hypothetical protein 29 2.5 At1g14200.1 68414.m01680 zinc finger (C3HC4-type RING finger) fa... 29 2.5 At3g15050.1 68416.m01904 calmodulin-binding family protein simil... 29 3.3 At2g13680.1 68415.m01508 glycosyl transferase family 48 protein ... 28 7.7 At1g06150.1 68414.m00646 pentatricopeptide (PPR) repeat-containi... 28 7.7 >At1g24450.1 68414.m03080 ribonuclease III family protein contains similarity to Swiss-Prot:P51837 ribonuclease III (EC 3.1.26.3) (RNase III) [Coxiella burnetii] Length = 191 Score = 33.1 bits (72), Expect = 0.20 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Frame = +3 Query: 42 ITNTAMHLEITMGDIGLTTKVLDRLIIHQDPLRTSC-LDQDQDQCLGLYP-IKTHSEEDL 215 I TA+ L+ DI +++K L RLI + +SC LD D+ LGL I+ ++ D Sbjct: 89 IIETAVSLQFLAKDIDISSKALGRLISEVSNVESSCALDGDR---LGLGKIIRVSTKTDA 145 Query: 216 VRMALLC 236 A+LC Sbjct: 146 SNSAILC 152 >At1g19030.1 68414.m02369 hypothetical protein Length = 398 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -3 Query: 199 WVLIG*RPKHWSWSWSKHEVRRGSWWMIKRSRT 101 W ++ R W K+ +RRGS+W++K + T Sbjct: 121 WRILSARRSLWVELVKKYLIRRGSFWLVKENTT 153 >At1g14200.1 68414.m01680 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 179 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/56 (25%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Frame = +1 Query: 292 KDSLKNIPREILHKIEPEYCGVCALELDSFG----MSRLHYLSKNHAKNLRKWVSK 447 K ++N+PR ++ + + +Y G CA+ LD + + + K H+K + +W+ + Sbjct: 87 KSEVENMPRVVIGEDKEKYGGSCAICLDEWSKGDVAAEMPCKHKFHSKCVEEWLGR 142 >At3g15050.1 68416.m01904 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 259 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 169 WSWSWSKHEVRRGSWWMIKRSRTLVVRPISP 77 W WSW + + W + R++ VV+PI P Sbjct: 199 WGWSWKERWIAARPWEI--RAQCYVVKPIKP 227 >At2g13680.1 68415.m01508 glycosyl transferase family 48 protein contains Pfam profile: PF02364 1,3-beta-glucan synthase Length = 1923 Score = 27.9 bits (59), Expect = 7.7 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +2 Query: 521 STLYVHINFNFLN*TSLT*LVFNYLKVNSKLSYCIVLSAYYGALYSFS 664 S L V +NF + T ++ N LK+ L++C+VL Y SF+ Sbjct: 534 SVLDVILNFPGFHRWKFTDVLRNILKIVVSLAWCVVLPLCYAQSVSFA 581 >At1g06150.1 68414.m00646 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 1322 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 271 LMRCGLTKDSLK-NIPREILHKIEPEYCGVCALELDSFGMSRLHYLSKNHAKNL 429 LM+C + S + IP + LH+ P++ G +D G++ + + N + +L Sbjct: 170 LMQCDINSPSDRPKIPSKCLHEASPDFSGEFDKAMDMEGLNIVSQNTSNRSNDL 223 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,444,576 Number of Sequences: 28952 Number of extensions: 335743 Number of successful extensions: 906 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 906 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -