BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0777 (814 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC24C9.07c |bgs2|meu21, pgs2|1,3-beta-glucan synthase subunit ... 29 0.59 SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit ... 27 2.4 SPAC13A11.06 ||SPAC3H8.01|pyruvate decarboxylase |Schizosaccharo... 26 5.5 SPBC776.13 |cnd1||condensin subunit Cnd1|Schizosaccharomyces pom... 26 7.3 SPBC146.03c |cut3|smc4, smc4|condensin subunit Cut3|Schizosaccha... 25 9.7 SPBC18E5.09c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 25 9.7 SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual 25 9.7 >SPAC24C9.07c |bgs2|meu21, pgs2|1,3-beta-glucan synthase subunit Bgs2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1894 Score = 29.5 bits (63), Expect = 0.59 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 209 AWV*RNTSFNFVWIIHFTIY 150 +W T+FN +W+IHFT Y Sbjct: 478 SWFHLVTNFNRIWVIHFTTY 497 >SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit Bgs4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1955 Score = 27.5 bits (58), Expect = 2.4 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -3 Query: 209 AWV*RNTSFNFVWIIHFTIYLCF*RFLIKTYLIVTVSYYQK 87 +W T+FN +W+IHF ++ F F T + T ++Q+ Sbjct: 508 SWFHLITNFNRIWVIHFGMFWYFTAFNSPT--LYTKPFHQR 546 >SPAC13A11.06 ||SPAC3H8.01|pyruvate decarboxylase |Schizosaccharomyces pombe|chr 1|||Manual Length = 571 Score = 26.2 bits (55), Expect = 5.5 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = -1 Query: 334 HKLLALRNFSPMVTMAANHAIRQS*FWYDGYMLTSDLANSGKPGYSGTRLLISSG 170 H+L+ L +F VT AI ++ ++DG + S K T LL+S G Sbjct: 235 HELIKLTHFPTYVTPMGKSAIDETSQFFDGVYVGSISDPEVKDRIESTDLLLSIG 289 >SPBC776.13 |cnd1||condensin subunit Cnd1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1158 Score = 25.8 bits (54), Expect = 7.3 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = -1 Query: 217 SGKPGYSGTRLLISSGLFILQFICVFNGFLSKHI 116 S ++ LL+++ L + +F+C+ N F +H+ Sbjct: 929 SNHKSHNNQSLLLAASLTLSKFMCLSNNFCMEHL 962 >SPBC146.03c |cut3|smc4, smc4|condensin subunit Cut3|Schizosaccharomyces pombe|chr 2|||Manual Length = 1324 Score = 25.4 bits (53), Expect = 9.7 Identities = 13/44 (29%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +2 Query: 332 MKELHSFEKLQANA-LDGVRVHREFSQGILSHVIPPRRYMQKLT 460 +KE++ + NA L+ V FS+G+L V+PP++ + ++ Sbjct: 1185 LKEMYQIITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWKNIS 1228 >SPBC18E5.09c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 128 Score = 25.4 bits (53), Expect = 9.7 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 759 LIITHLVLSSTYWSYNL 709 L L+L STYWSY+L Sbjct: 83 LFTVRLLLFSTYWSYSL 99 >SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual Length = 1339 Score = 25.4 bits (53), Expect = 9.7 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 159 YNLFVFLTVSYQNISNSDC 103 YN+ FL+V++QN DC Sbjct: 524 YNMLFFLSVNFQNPGLKDC 542 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,413,417 Number of Sequences: 5004 Number of extensions: 75490 Number of successful extensions: 154 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 396433620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -