BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0775 (808 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0120 - 19932330-19932366,19932562-19932781,19932876-199329... 30 2.5 01_06_0372 + 28828552-28829913 30 2.5 >02_04_0120 - 19932330-19932366,19932562-19932781,19932876-19932987, 19933071-19933226,19933307-19933471,19933723-19934160, 19934822-19935009,19935465-19935531,19936160-19936332, 19937176-19937308,19937399-19937546,19937622-19937815, 19938855-19939058,19939760-19939834 Length = 769 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 258 RKIYTTNVLIIMMMFGVGREAQLASDTAEWSWCGAALCG 142 +K Y+ +L+ ++ FGV L ++ A +W ALCG Sbjct: 378 QKGYSITILLAVVTFGVSTRWLLYTEQAPSAWLNFALCG 416 >01_06_0372 + 28828552-28829913 Length = 453 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -2 Query: 213 GVGREAQLASDTAEWSWCGA-ALCGPSSGTPMYMTWCCGSSXFMPSADCT 67 G+ EA SD W+ CGA A C P G+P Y S+ F+ D T Sbjct: 104 GLSGEADTGSDLI-WTKCGACARCSP-RGSPSYYPTSSSSAAFVACGDRT 151 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,388,616 Number of Sequences: 37544 Number of extensions: 226733 Number of successful extensions: 468 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2197677108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -