BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0774 (827 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0496 + 16549333-16549465,16549620-16550020,16550412-165508... 29 4.5 >04_03_0496 + 16549333-16549465,16549620-16550020,16550412-16550880, 16552038-16552076,16553151-16553272,16553531-16553677, 16554097-16554186,16554274-16554398,16554567-16554772, 16554951-16555075,16555528-16555722,16556295-16556337, 16556762-16557267,16558198-16558570,16559772-16560062, 16560132-16561101,16561196-16561892,16562378-16562658, 16562731-16563400,16563860-16564034,16565103-16565659 Length = 2204 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 526 YNVIEYKTFSIHQSIL*LCFLRP*SFFFLI 615 Y+VI ++F + IL LC+L P SFF ++ Sbjct: 2149 YDVILKESFVVIMDILRLCYLAPSSFFVVV 2178 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,759,579 Number of Sequences: 37544 Number of extensions: 311290 Number of successful extensions: 489 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2279943096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -