BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0774 (827 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF450111-1|AAP46292.1| 911|Homo sapiens voltage-gated potassium... 31 6.7 AF338730-1|AAK16585.1| 911|Homo sapiens potassium voltage-gated... 31 6.7 >AF450111-1|AAP46292.1| 911|Homo sapiens voltage-gated potassium channel alpha subunit Kv2.2 protein. Length = 911 Score = 30.7 bits (66), Expect = 6.7 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 3/31 (9%) Frame = -2 Query: 85 SLEMNKLEQNLISPK---NPGNTVYCPTKLT 2 S E K+E +L +P+ NPG+T YCPT+ T Sbjct: 879 SQEGCKMENHLFAPEIHSNPGDTGYCPTRET 909 >AF338730-1|AAK16585.1| 911|Homo sapiens potassium voltage-gated channel, Shab-related subfamily, member 2 protein. Length = 911 Score = 30.7 bits (66), Expect = 6.7 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 3/31 (9%) Frame = -2 Query: 85 SLEMNKLEQNLISPK---NPGNTVYCPTKLT 2 S E K+E +L +P+ NPG+T YCPT+ T Sbjct: 879 SQEGCKMENHLFAPEIHSNPGDTGYCPTRET 909 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,205,012 Number of Sequences: 237096 Number of extensions: 1793176 Number of successful extensions: 2558 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2558 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10370898348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -