BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0772 (711 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1919.12c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|... 29 0.66 SPCC736.12c |||conserved protein|Schizosaccharomyces pombe|chr 3... 27 2.0 >SPCC1919.12c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|||Manual Length = 843 Score = 29.1 bits (62), Expect = 0.66 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 608 FLFSAKNCNISICYISYY*WDFGNL 682 FLFS +CN S+CY DFG L Sbjct: 699 FLFSNGSCNTSLCYYESTDPDFGGL 723 >SPCC736.12c |||conserved protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 437 Score = 27.5 bits (58), Expect = 2.0 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 298 LSFYRPQI*LDLNEILKLVNAFIKLCDSETIKIKKYLQLLIWRI 429 +S P++ LD N I FI LCD+ET I + IW + Sbjct: 332 ISMINPRVVLDENGISHRSRYFIMLCDNET-AIAHAKKTSIWAV 374 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,659,902 Number of Sequences: 5004 Number of extensions: 50882 Number of successful extensions: 99 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 331187010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -