BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0772 (711 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31339| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_26972| Best HMM Match : Bro-N (HMM E-Value=3.4) 31 1.2 SB_17727| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-12) 29 4.9 SB_3992| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_13020| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_49481| Best HMM Match : Trigger_C (HMM E-Value=1.6) 28 8.6 SB_22264| Best HMM Match : UDPGT (HMM E-Value=6.4e-11) 28 8.6 >SB_31339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 262 VNPFYYTMAFSCLSFYRPQI*LDLNEILKLVNAFIKL 372 +NPFY+ + FS L +R QI D I+K + +K+ Sbjct: 86 LNPFYFKIRFSFLDTFRIQIADDSGNIIKFQSGAVKV 122 >SB_26972| Best HMM Match : Bro-N (HMM E-Value=3.4) Length = 323 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 262 VNPFYYTMAFSCLSFYRPQI*LDLNEILKLVNAFIKL 372 +NPFY+ + FS L +R QI D I+K + +K+ Sbjct: 278 LNPFYFKIRFSFLDTFRIQIADDSGNIIKFQSGAVKV 314 >SB_17727| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-12) Length = 648 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 107 IFSFFINLL*NKEYHTYPNKVISVS 33 +FS F +L NK Y T PNK I +S Sbjct: 531 VFSLFASLNENKSYITIPNKFIKLS 555 >SB_3992| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 354 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 107 IFSFFINLL*NKEYHTYPNKVISVS 33 +FS F +L NK Y T PNK I +S Sbjct: 133 VFSLFASLNENKSYITIPNKFIKLS 157 >SB_13020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 722 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 107 IFSFFINLL*NKEYHTYPNKVISVS 33 +FS F +L NK Y T PNK I +S Sbjct: 347 VFSLFASLNENKSYITIPNKFIKLS 371 >SB_49481| Best HMM Match : Trigger_C (HMM E-Value=1.6) Length = 342 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 Query: 614 FSAKNCNISICYISYY*WDFGNLIGCEI 697 + KN N+SICYIS DF L CE+ Sbjct: 111 YVGKNINVSICYISL---DFVTLRVCEL 135 >SB_22264| Best HMM Match : UDPGT (HMM E-Value=6.4e-11) Length = 385 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +1 Query: 268 PFYYTMAFSCLSFYRPQI*LDLNEILKLVNAFIKLCDSETIKIKK 402 PFY L+ + + + +L LVNA +K+C +++ + KK Sbjct: 339 PFYQLYMLDVLAVLVMALLILIALVLSLVNAVVKMCKNDSSETKK 383 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,629,077 Number of Sequences: 59808 Number of extensions: 337660 Number of successful extensions: 571 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 566 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -