BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0772 (711 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z29560-12|CAL22705.1| 395|Caenorhabditis elegans Hypothetical p... 28 7.6 AF016423-8|AAB65319.1| 409|Caenorhabditis elegans Hypothetical ... 28 7.6 >Z29560-12|CAL22705.1| 395|Caenorhabditis elegans Hypothetical protein K03H1.13 protein. Length = 395 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -1 Query: 69 ISYLPEQSYFSFSTGSV 19 IS LPEQS+ FSTGS+ Sbjct: 321 ISKLPEQSFVEFSTGSL 337 >AF016423-8|AAB65319.1| 409|Caenorhabditis elegans Hypothetical protein F40A3.7 protein. Length = 409 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -3 Query: 496 LFCTILVVYSLQRLKWFVRHYYIFAKLTIVNI 401 LF IL YS W+ R +Y+ +K+ ++++ Sbjct: 76 LFPNILANYSFFTFNWYFRWFYLHSKVHLISL 107 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,354,951 Number of Sequences: 27780 Number of extensions: 275863 Number of successful extensions: 531 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 531 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1655655746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -