BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0771 (815 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10683| Best HMM Match : Stathmin (HMM E-Value=0.0011) 34 0.12 SB_56390| Best HMM Match : CHASE3 (HMM E-Value=0.042) 32 0.48 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 32 0.48 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 32 0.48 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 32 0.48 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 32 0.64 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 31 0.84 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_44588| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_17373| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) 31 1.1 SB_46988| Best HMM Match : HEAT (HMM E-Value=8.6e-06) 31 1.1 SB_10354| Best HMM Match : AT_hook (HMM E-Value=0.045) 31 1.1 SB_21989| Best HMM Match : Spectrin (HMM E-Value=0) 31 1.5 SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 30 2.0 SB_39788| Best HMM Match : Ricin_B_lectin (HMM E-Value=6.4e-14) 30 2.0 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_24737| Best HMM Match : KID (HMM E-Value=0.096) 30 2.6 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 30 2.6 SB_16340| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_6334| Best HMM Match : zf-C2H2 (HMM E-Value=1.5e-26) 29 3.4 SB_54674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_35915| Best HMM Match : DUF593 (HMM E-Value=0.12) 29 4.5 SB_28574| Best HMM Match : KE2 (HMM E-Value=1.2) 29 4.5 SB_25602| Best HMM Match : Endomucin (HMM E-Value=1.1) 29 4.5 SB_18775| Best HMM Match : DUF1409 (HMM E-Value=0.78) 29 4.5 SB_14736| Best HMM Match : Exonuc_VII_S (HMM E-Value=1.2) 29 4.5 SB_14482| Best HMM Match : Cornifin (HMM E-Value=3.7) 29 4.5 SB_13377| Best HMM Match : Extensin_2 (HMM E-Value=0.00046) 29 4.5 SB_41994| Best HMM Match : F-box (HMM E-Value=1.4e-06) 29 4.5 SB_16617| Best HMM Match : Vicilin_N (HMM E-Value=5.5) 29 4.5 SB_11461| Best HMM Match : NHL (HMM E-Value=0) 29 6.0 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_23841| Best HMM Match : LRR_1 (HMM E-Value=1e-09) 29 6.0 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 29 6.0 SB_48415| Best HMM Match : Pox_A32 (HMM E-Value=0.014) 28 7.9 SB_12695| Best HMM Match : Linker_histone (HMM E-Value=1.6e-38) 28 7.9 SB_44228| Best HMM Match : LMP (HMM E-Value=0.11) 28 7.9 SB_36607| Best HMM Match : Vicilin_N (HMM E-Value=3.7) 28 7.9 >SB_10683| Best HMM Match : Stathmin (HMM E-Value=0.0011) Length = 299 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/50 (32%), Positives = 32/50 (64%) Frame = +1 Query: 502 RQVETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKM 651 +++E +EKR++Y+ L++RL + VE+ R T+E+ K +E+K+ Sbjct: 207 QKMEMTKEKRDSYMEALKTRLHEKSLDVEQKRQTMEEIQMFQRKILEEKL 256 Score = 32.7 bits (71), Expect = 0.37 Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 9/94 (9%) Frame = +1 Query: 541 INELRSRLKDHLEGVEK--------TRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMI 696 I ELRS ++ L+ E+ + +EQQ+ + + I KM +KRD ++ + Sbjct: 165 IEELRSAKEEKLQAHERRVRVAQSIAQEQIEQQSKLIEEKIMQKMEMTKEKRDSYMEALK 224 Query: 697 ERLRET*GTSSQGPRR*PGEVQSFESAI-QEKLQ 795 RL E + R+ E+Q F+ I +EKLQ Sbjct: 225 TRLHEK-SLDVEQKRQTMEEIQMFQRKILEEKLQ 257 >SB_56390| Best HMM Match : CHASE3 (HMM E-Value=0.042) Length = 440 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/65 (24%), Positives = 37/65 (56%), Gaps = 2/65 (3%) Frame = +1 Query: 541 INELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDE--NLKKMIERLRET 714 +N+ +L + +EG++ T +TL+QQ ++ + + + TT+ + R + ++K + +E Sbjct: 251 LNDFVIQLDEEVEGMQSTIMTLQQQIKDIKQRLATETTTSQELRTKCHQVEKCLSEAKEQ 310 Query: 715 *GTSS 729 T S Sbjct: 311 NATLS 315 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 32.3 bits (70), Expect = 0.48 Identities = 22/96 (22%), Positives = 46/96 (47%) Frame = +1 Query: 499 RRQVETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDE 678 +R E E +++ + S +KD L+ + LEQ+ E+ + E ++ +K DE Sbjct: 629 QRNQEVFEAQQKEQFEKQLSLVKDELQPYKSKCQELEQENKELMEKYERDLSELKNKMDE 688 Query: 679 NLKKMIERLRET*GTSSQGPRR*PGEVQSFESAIQE 786 + ER + T +G + E+Q +++ ++E Sbjct: 689 ----VEERYKMTENIEEEGMKTLEHELQIYKAKVKE 720 Score = 29.9 bits (64), Expect = 2.6 Identities = 20/76 (26%), Positives = 42/76 (55%), Gaps = 4/76 (5%) Frame = +1 Query: 496 SRRQVETHEEKREAYINELRSRLKDHLEGVEKTRLT---LEQQTAEVYKAIED-KMTTAA 663 ++ ++E+ +EK E+ + ELR++L D LE + L +++ A + +E+ K A Sbjct: 115 TQMEMESEQEKHESELEELRAQL-DKLENSDTESLVEERMKELKANYEREVEELKERLAK 173 Query: 664 DKRDENLKKMIERLRE 711 + D ++ ER++E Sbjct: 174 GESDARDSELTERIQE 189 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/75 (24%), Positives = 43/75 (57%), Gaps = 5/75 (6%) Frame = +1 Query: 502 RQVETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEV---YKAIEDKMTTAADKR 672 ++ E + + E ++EL + E VEK +++ +++ YKA+E+K + +++ Sbjct: 941 KEAENSKLETERQLSELSKETCHYKEKVEKQNQEIQELQSKINLLYKAVEEKDSEINNQK 1000 Query: 673 --DENLKKMIERLRE 711 ++NL K+++ +RE Sbjct: 1001 IENDNLGKVVDSMRE 1015 >SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) Length = 483 Score = 32.3 bits (70), Expect = 0.48 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +2 Query: 212 HHHRNPLPRDVEGRLAYEVILAEPVGVPVPRRADSPEKTP 331 HHH +P P V R+ + V PV VPVP R P +P Sbjct: 209 HHHHHPFPVRVPVRVPFRV----PVRVPVPVRVPVPIHSP 244 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 31.9 bits (69), Expect = 0.64 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 2/103 (1%) Frame = +1 Query: 409 HCSEDGQDRGGVPHPQRADE*LHRRHQGGSRRQVETH-EEKREAYINELRSRLKDHLEG- 582 H E+ QD+ G + L + QVE E++RE + E ++ +D +E Sbjct: 61 HYIEEDQDKLGEALEEERQRMLQEKSDW--LEQVERQMEQEREVFAKE-KAEFQDQIENQ 117 Query: 583 VEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMIERLRE 711 +EK R L + AE+ + +E ++ D + ++ +ER+ E Sbjct: 118 IEKEREILAKARAEIQEQMEGQIGQERDILAKEKEEFMERMYE 160 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 31.5 bits (68), Expect = 0.84 Identities = 21/55 (38%), Positives = 28/55 (50%) Frame = +1 Query: 547 ELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMIERLRE 711 E R KD E EK R +QQ + K E K+ +KR++ +K ERLRE Sbjct: 908 EKEKREKDKREREEKERKRRQQQLEKEKKEKEKKLLIEKEKREKEKQK--ERLRE 960 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.5 bits (68), Expect = 0.84 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +2 Query: 494 ALDAKWRPTRKNARPTSTSCAPVSRIILRVLRRPG*PWNS 613 A + W RK ARP S SC+P + VL RP W+S Sbjct: 2 ACPSVWEQRRKPARPRSNSCSPGDPL---VLERPPPRWSS 38 >SB_44588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 135 PAAHRRSAPKKPVGKPRTKQPKK 203 PAA + +PKKP K TK PKK Sbjct: 118 PAAKKAKSPKKPAPKKATKSPKK 140 >SB_17373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 135 PAAHRRSAPKKPVGKPRTKQPKK 203 PAA + +PKKP K TK PKK Sbjct: 181 PAAKKAKSPKKPAPKKATKSPKK 203 >SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) Length = 1177 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = +1 Query: 484 HQGGSRRQ-VETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTA 660 +QG S+ Q + H EK EA NE++ + K+ L+ +++ +E++ E K++ D++ Sbjct: 456 NQGKSKEQEAQEHSEKYEALKNEMQQQGKEWLKQDKESHKQIEEREKEC-KSLRDEVRKL 514 Query: 661 AD 666 D Sbjct: 515 RD 516 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/69 (24%), Positives = 37/69 (53%), Gaps = 3/69 (4%) Frame = +1 Query: 502 RQVETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAAD---KR 672 +++ T +EK + + ++L+D L K++ Q+ +E Y+A++++M K+ Sbjct: 430 KRMATEQEKESKSLRKKNNQLEDELTNQGKSKEQEAQEHSEKYEALKNEMQQQGKEWLKQ 489 Query: 673 DENLKKMIE 699 D+ K IE Sbjct: 490 DKESHKQIE 498 >SB_46988| Best HMM Match : HEAT (HMM E-Value=8.6e-06) Length = 1231 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/92 (22%), Positives = 42/92 (45%) Frame = +1 Query: 523 EKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMIER 702 E+ E E R K+ + +E+ +Q K ED++ K L+KM+++ Sbjct: 927 ERMERKRREEEERAKEQMR-IEEIEQEKSKQLQLQQKEEEDRLRKKIMKEQRELEKMLQQ 985 Query: 703 LRET*GTSSQGPRR*PGEVQSFESAIQEKLQQ 798 + Q ++ ++Q E A++E+LQ+ Sbjct: 986 KEKERQVERQKQKQLQEQLQEQEKALRERLQR 1017 >SB_10354| Best HMM Match : AT_hook (HMM E-Value=0.045) Length = 191 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +3 Query: 150 RSAPKKPVGKPRTKQPKKVK 209 R PKK G+P TK+PKKVK Sbjct: 107 RGRPKKADGEPATKKPKKVK 126 >SB_21989| Best HMM Match : Spectrin (HMM E-Value=0) Length = 1805 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/72 (23%), Positives = 38/72 (52%) Frame = +1 Query: 481 RHQGGSRRQVETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTA 660 ++Q R T E EA +++L + EG+ +++++L++ +E++ +EDK Sbjct: 445 QYQEDIERHQLTKERLHEA-VSDLLELTRGETEGLRESQISLDENWSELWALLEDKEEEL 503 Query: 661 ADKRDENLKKMI 696 +R + L M+ Sbjct: 504 LRRRGDLLVVML 515 >SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 30.7 bits (66), Expect = 1.5 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = +1 Query: 517 HEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAAD-KRDENLKKM 693 +E +++A I + R +L +E RL+ E + A + K + M A + KR ENL KM Sbjct: 328 YEYEQKAKIEKERDKLV-----IEVERLSDEMKKAGLPKEVLSLMNDAREEKRSENLSKM 382 Query: 694 IERLRET 714 ++L ET Sbjct: 383 EKKLSET 389 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/26 (42%), Positives = 20/26 (76%) Frame = +3 Query: 132 LPAAHRRSAPKKPVGKPRTKQPKKVK 209 LP + +++ +KP+GKP T++ KKV+ Sbjct: 6138 LPVSAKKAVEEKPLGKPITRKEKKVE 6163 >SB_39788| Best HMM Match : Ricin_B_lectin (HMM E-Value=6.4e-14) Length = 784 Score = 30.3 bits (65), Expect = 2.0 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 4/86 (4%) Frame = +1 Query: 496 SRRQVETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTT---AAD 666 SR +V H+E + IN+L + + L+ + +L Q E ++ DK++ +D Sbjct: 536 SRSKVNGHKETVDKAINDLSEKFNESLQRMNNKISSLHQVLHEKRSSMADKISELRFTSD 595 Query: 667 KRDENLKKMIERLR-ET*GTSSQGPR 741 K + N L + G SQG R Sbjct: 596 KSESNTSTPTNSLTFNSKGDISQGDR 621 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/83 (24%), Positives = 44/83 (53%), Gaps = 3/83 (3%) Frame = +1 Query: 472 LHRRHQGGSRRQVETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIED-- 645 L RR + + ++ EK+ E ++ L++ L ++KT+ L Q+ E+++A E+ Sbjct: 2856 LERRRETEAVKKEMVATEKKVKLFLEKQNLLEEKLLLLQKTKEELRQKETELHEAREEIT 2915 Query: 646 -KMTTAADKRDENLKKMIERLRE 711 M +D+ +KK+++ + E Sbjct: 2916 VLMNRIESSKDKQIKKVMKAVCE 2938 >SB_24737| Best HMM Match : KID (HMM E-Value=0.096) Length = 636 Score = 29.9 bits (64), Expect = 2.6 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 2/93 (2%) Frame = +1 Query: 523 EKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTA--ADKRDENLKKMI 696 E RE I++L LKD + + TLEQ A++ + +E K A + R L+K + Sbjct: 148 EDREKSIDKLEKELKDQEAKHNRQKNTLEQTVAKMKEVMERKGGDANKVNARVAELEKEL 207 Query: 697 ERLRET*GTSSQGPRR*PGEVQSFESAIQEKLQ 795 + ++ + + EV + + A+Q++ Q Sbjct: 208 KEKTKSAEKLVKASEKREKEVDALKRALQDQDQ 240 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/82 (20%), Positives = 38/82 (46%), Gaps = 1/82 (1%) Frame = +1 Query: 472 LHRRHQGGSRRQVETHEEKREAYINELRSRLKDHLEGVEKT-RLTLEQQTAEVYKAIEDK 648 + RH+ ++ + + E +NE L H+E +K R +Q E+ +++ Sbjct: 10 MEARHEAARAKEETERQAELERQMNERLQELHAHMEKSDKNMREAHRKQIQEISSKHKEE 69 Query: 649 MTTAADKRDENLKKMIERLRET 714 + ++ ++LKK +L+ T Sbjct: 70 LQQQLERFHQDLKKKDAKLKTT 91 >SB_16340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.9 bits (64), Expect = 2.6 Identities = 21/64 (32%), Positives = 31/64 (48%) Frame = +1 Query: 523 EKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMIER 702 EK E + RLKD + K LE+Q ++ D+M ++ +E LK + ER Sbjct: 145 EKNITTAMEQQKRLKDSYDETVKRNQELEEQVLKM----ADEMQEERERFEEALKVVTER 200 Query: 703 LRET 714 L ET Sbjct: 201 LVET 204 >SB_6334| Best HMM Match : zf-C2H2 (HMM E-Value=1.5e-26) Length = 611 Score = 29.5 bits (63), Expect = 3.4 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +1 Query: 499 RRQVETHE-EKREAY-INELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKR 672 +R + TH EKR A I R DHL KT + + A+ K+ ++K T + D+R Sbjct: 318 QRHLRTHTGEKRFACPICSKRFMRSDHLSKHVKTHNNITPKKADSEKSEDEKTTNSEDQR 377 Query: 673 DE 678 E Sbjct: 378 SE 379 >SB_54674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 29.5 bits (63), Expect = 3.4 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 1/73 (1%) Frame = +1 Query: 496 SRRQVETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVY-KAIEDKMTTAADKR 672 S+ Q E + + E + SR+ + + + +++ ++ K+ AA R Sbjct: 974 SKHQQELAQIRAEFAVRHSNSRVAELQSKMASLEIVIQKLRDKLAAKSGSSDALAAAKAR 1033 Query: 673 DENLKKMIERLRE 711 +ENLK+ IERL E Sbjct: 1034 EENLKQQIERLNE 1046 >SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1507 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/94 (17%), Positives = 44/94 (46%) Frame = +1 Query: 508 VETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLK 687 V+ +E+ EAYI L+ + LE +++ +++ + +ED + ++ + + Sbjct: 257 VKALKEENEAYIEALKEQYSHDLEDLKQELSAKDEEILQKEAQMEDDLLLMRNEYESQVS 316 Query: 688 KMIERLRET*GTSSQGPRR*PGEVQSFESAIQEK 789 + + T + + + E+Q +++ + EK Sbjct: 317 ALRAEIERTKESGNAALKDAMEELQKYKAEVTEK 350 >SB_35915| Best HMM Match : DUF593 (HMM E-Value=0.12) Length = 371 Score = 29.1 bits (62), Expect = 4.5 Identities = 17/72 (23%), Positives = 40/72 (55%), Gaps = 3/72 (4%) Frame = +1 Query: 502 RQVETHEEKREAYINEL---RSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKR 672 +Q+E E++ ++E+ R+ + DH+ +E R+TL+++ + D++ + Sbjct: 280 QQLEEVSEQKNNLLHEMGVVRTEIADHVTILEDLRITLQERNGTIEGLKADRL-----RL 334 Query: 673 DENLKKMIERLR 708 +E L+ + +RLR Sbjct: 335 EEELRALSDRLR 346 >SB_28574| Best HMM Match : KE2 (HMM E-Value=1.2) Length = 210 Score = 29.1 bits (62), Expect = 4.5 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 5/85 (5%) Frame = +1 Query: 472 LHRRHQGGSRRQVETH---EEKREAYINELRSRLKDHLEGVEKTRLTLEQ--QTAEVYKA 636 L HQ R+Q+++ +E+++ I L ++K E R+ L + Q A YK Sbjct: 120 LSSEHQEVHRQQMQSFNSLKEQKKMEIINLEEQIKTFKEQAASLRVRLSEVEQDAAYYKG 179 Query: 637 IEDKMTTAADKRDENLKKMIERLRE 711 + +K ++ + + +RLRE Sbjct: 180 LHNKGLLDIQRQQTTIISLNQRLRE 204 >SB_25602| Best HMM Match : Endomucin (HMM E-Value=1.1) Length = 393 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +1 Query: 487 QGGSRRQVETHEEKR-EAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAA 663 +G + H+ + E I LRS + + V K +L + +K I++K+T+AA Sbjct: 180 KGNKMEEQVVHDARECECKIEMLRSEVSASINDVAKKISSLTSKVTSEFKLIKNKLTSAA 239 Query: 664 D 666 + Sbjct: 240 E 240 >SB_18775| Best HMM Match : DUF1409 (HMM E-Value=0.78) Length = 356 Score = 29.1 bits (62), Expect = 4.5 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = +2 Query: 197 EEGQIHHHRNPLPRDVEGRLAYEVILAEPVGVPVPRRADSPEKTPSVEEIQEKLKAAEER 376 E+ QI +P D + ++++ + +P AD K P EEI EKLK +E+ Sbjct: 165 EQSQIQLKTINIPLDGINKSPAQLMIGRRLKTSLPATADLL-KPPGQEEITEKLKKIKEK 223 Query: 377 RR 382 ++ Sbjct: 224 QK 225 >SB_14736| Best HMM Match : Exonuc_VII_S (HMM E-Value=1.2) Length = 206 Score = 29.1 bits (62), Expect = 4.5 Identities = 23/100 (23%), Positives = 50/100 (50%), Gaps = 4/100 (4%) Frame = +1 Query: 499 RRQVETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRD- 675 R+ E E+++ + L+ L D + + L + + E+ + ++D+ + ++D Sbjct: 24 RQDFEKAFEEKDTTVQNLKKILDDSRKTNYELGRELSKNSTELQR-VKDEFDSIIHEKDS 82 Query: 676 --ENLKKMIERLRET*GTSSQGPRR*PGEVQS-FESAIQE 786 +NL+ IE +R+ G + GEVQ+ ++S I+E Sbjct: 83 VVDNLRIRIEEMRKERGEMEDRSKAVIGEVQTRYDSKIRE 122 >SB_14482| Best HMM Match : Cornifin (HMM E-Value=3.7) Length = 301 Score = 29.1 bits (62), Expect = 4.5 Identities = 21/64 (32%), Positives = 25/64 (39%), Gaps = 2/64 (3%) Frame = +3 Query: 621 GSVQGHRR*--DDHSCRQA*REPQEDDRASARNMRNKFARSAPVTRRSSELRERHPGEAS 794 G QG R DD ++ +EP + R AR A VT HPG Sbjct: 2 GKPQGSTRAQPDDQLAQELAQEPGKPAREPARTPVAALPAPARVTSPEPPATRPHPGRVE 61 Query: 795 AGRR 806 AGRR Sbjct: 62 AGRR 65 >SB_13377| Best HMM Match : Extensin_2 (HMM E-Value=0.00046) Length = 797 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +2 Query: 209 IHHHRNPLPRDVEGRLAYEVILAEPVGVPVPRRADSPEK 325 +H RNPLP R+ + + P PR DSP K Sbjct: 357 LHSPRNPLPAYFTPRVLHSPPRTSLLAYPTPRVLDSPRK 395 >SB_41994| Best HMM Match : F-box (HMM E-Value=1.4e-06) Length = 1020 Score = 29.1 bits (62), Expect = 4.5 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 5/85 (5%) Frame = +1 Query: 472 LHRRHQGGSRRQVETH---EEKREAYINELRSRLKDHLEGVEKTRLTLEQ--QTAEVYKA 636 L HQ R+Q+++ +E+++ I L ++K E R+ L + Q A YK Sbjct: 20 LSSEHQEVHRQQMQSFNSLKEQKKMEIINLEEQIKTFKEQAASLRVRLSEVEQDAAYYKG 79 Query: 637 IEDKMTTAADKRDENLKKMIERLRE 711 + +K ++ + + +RLRE Sbjct: 80 LHNKGLLDIQRQQTTIISLNQRLRE 104 >SB_16617| Best HMM Match : Vicilin_N (HMM E-Value=5.5) Length = 547 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +3 Query: 663 RQA*REPQEDDRASARNMRNKFARSAPVTRRSSELRERHPGEASAGRRPTS 815 RQA R+PQ+ AS + + + R A ++S+L+++ A R TS Sbjct: 237 RQASRKPQDKQAASPKTSKPQAPRQASRKTKTSKLQDQDKQAARQASRKTS 287 >SB_11461| Best HMM Match : NHL (HMM E-Value=0) Length = 819 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +1 Query: 664 DKRDENLKKMIERLRET*GTSSQGPRR*PGEVQSFESAIQ---EKLQQAAD 807 DK+ E++ +MIERL +S G E + +E IQ E+L Q D Sbjct: 108 DKKRESILRMIERLEVEISSSEDGETELTNETKQYEVHIQSNNERLVQKED 158 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 28.7 bits (61), Expect = 6.0 Identities = 26/100 (26%), Positives = 40/100 (40%), Gaps = 2/100 (2%) Frame = +3 Query: 516 PRGKTRGLHQRAALPSQGSS*GC*EDQVDPGTADRGSVQGHR--R*DDHSCRQA*REPQE 689 PRG RG + P + S +D P DR + R R DD + R+ R+P+ Sbjct: 303 PRGDDRGQMKDDREPMKDDS-KLRKDNKGPRKDDREPRRDDREPRRDDRATRKDDRQPRG 361 Query: 690 DDRASARNMRNKFARSAPVTRRSSELRERHPGEASAGRRP 809 DDR ++ R + + + S+ R R P Sbjct: 362 DDRGQMKDDREPMKDDSKLRKDESKPRRDDKEPRKDDREP 401 >SB_23841| Best HMM Match : LRR_1 (HMM E-Value=1e-09) Length = 391 Score = 28.7 bits (61), Expect = 6.0 Identities = 25/85 (29%), Positives = 35/85 (41%) Frame = +3 Query: 534 GLHQRAALPSQGSS*GC*EDQVDPGTADRGSVQGHRR*DDHSCRQA*REPQEDDRASARN 713 G +R + +Q S +DQV P GS G D + REP +DD + R Sbjct: 8 GCIRRVPVTAQSSVSDTEDDQVVPPDELNGSSDGEY--DTDLEEEFKREPSQDDTSQGRG 65 Query: 714 MRNKFARSAPVTRRSSELRERHPGE 788 + K S + S LR+ H E Sbjct: 66 VYLKACSSLGLVPCSPFLRQLHKPE 90 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 1/64 (1%) Frame = +1 Query: 523 EKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENL-KKMIE 699 +KR+ + + + + K+ +E EK R QQ E + ++ D+R+++L KK E Sbjct: 143 KKRDEFWTQEQQKEKERIEE-EKNRAAAHQQELERKRKEREEKQQEVDEREDHLQKKRSE 201 Query: 700 RLRE 711 LR+ Sbjct: 202 SLRK 205 >SB_48415| Best HMM Match : Pox_A32 (HMM E-Value=0.014) Length = 988 Score = 28.3 bits (60), Expect = 7.9 Identities = 16/53 (30%), Positives = 22/53 (41%) Frame = +3 Query: 648 DDHSCRQA*REPQEDDRASARNMRNKFARSAPVTRRSSELRERHPGEASAGRR 806 D+ ++ +EP + R AR +A VT HPG AGRR Sbjct: 788 DEQLAQELAQEPGKQRREPARTPVAALPAAARVTSPEPPATRPHPGRVEAGRR 840 >SB_12695| Best HMM Match : Linker_histone (HMM E-Value=1.6e-38) Length = 184 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 135 PAAHRRSAPKKPVGKPRTKQPKK 203 PAA + +PKK K TK PKK Sbjct: 118 PAAKKAKSPKKSAPKKATKSPKK 140 >SB_44228| Best HMM Match : LMP (HMM E-Value=0.11) Length = 276 Score = 28.3 bits (60), Expect = 7.9 Identities = 21/92 (22%), Positives = 47/92 (51%), Gaps = 4/92 (4%) Frame = +1 Query: 523 EKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRD---ENLKKM 693 E+++ + L+ L D + + L + + E+ + ++D+ + ++D +NL+ Sbjct: 7 EEKDTTVQNLKKILDDSRKTNYELERELSKNSTELQR-VKDEFDSIIHEKDSVVDNLRIR 65 Query: 694 IERLRET*GTSSQGPRR*PGEVQS-FESAIQE 786 IE +R+ G + GEVQ+ ++S I+E Sbjct: 66 IEEMRKERGEMEDRSKAVIGEVQTRYDSKIRE 97 >SB_36607| Best HMM Match : Vicilin_N (HMM E-Value=3.7) Length = 567 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +3 Query: 657 SCRQA*REPQEDDRASARNMRNKFARSAPVTRRSSELRE 773 SC++ +PQE D+ +AR ++ AR +R++ R+ Sbjct: 523 SCKKKTSKPQEKDKQAARKRPSQAARKRQASRKNKTSRK 561 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,179,619 Number of Sequences: 59808 Number of extensions: 476047 Number of successful extensions: 2078 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 1810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2068 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2275631710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -