BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0770 (814 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 29 0.17 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 29 0.17 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 23 8.5 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 29.1 bits (62), Expect = 0.17 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +3 Query: 534 FNKQQLERVLKEGTIKPDAIQIEVHLQNVQKEMVEFCQSEG 656 FN V EGTI PD + H + + V C +EG Sbjct: 545 FNTSASSSVTSEGTITPDLQTFDYHDEGGETSSVYSCDTEG 585 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 29.1 bits (62), Expect = 0.17 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +3 Query: 534 FNKQQLERVLKEGTIKPDAIQIEVHLQNVQKEMVEFCQSEG 656 FN V EGTI PD + H + + V C +EG Sbjct: 546 FNTSASSSVTSEGTITPDLQTFDYHDEGGETSSVYSCDTEG 586 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 23.4 bits (48), Expect = 8.5 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +1 Query: 370 SLKKLGLDYIDLYLMHWPIGLNADY 444 +L LG++Y+ + WPI Y Sbjct: 188 NLPSLGIEYVSYCIEDWPIAYGRVY 212 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 869,089 Number of Sequences: 2352 Number of extensions: 19241 Number of successful extensions: 32 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86071221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -