BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0769 (623 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 2.1 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 22 3.6 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 4.8 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 4.8 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 4.8 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +2 Query: 119 PAPATNPDPEPSXA*RP*LKQTMLXPCVNSVSESQDVTRT 238 P P P+P+P+ Q P +S ++ T+T Sbjct: 393 PEPVPTPEPQPTQTTESEPTQASEQPTESSTTQKPQTTKT 432 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 22.2 bits (45), Expect = 3.6 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -1 Query: 590 RKILNCPKGENRDNQRILPSPALFSLSAKTSGTFT 486 +KI N D LP P L++ SA T +FT Sbjct: 56 KKIYNIQNNFEYDTAS-LPLPGLYTKSANTIRSFT 89 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.8 bits (44), Expect = 4.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 77 GGTNTTRRLRGDRQPAPATNPD 142 GG N T L G +PA T PD Sbjct: 127 GGANLTNSLTGPVRPAACT-PD 147 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.8 bits (44), Expect = 4.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 321 LSNSFSCSSFXTVLGY 274 L NSFSCS LGY Sbjct: 240 LVNSFSCSCPSGTLGY 255 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 4.8 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +2 Query: 44 PTSTVAPPCGAGGTNTTRRLRGDRQP 121 P A P + + T R GDR+P Sbjct: 930 PCRNSASPASSDRSGTPRSTNGDRKP 955 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,508 Number of Sequences: 336 Number of extensions: 2139 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15979473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -