BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0769 (623 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1D4.02c |||human GRASP protein homolog |Schizosaccharomyces ... 26 5.1 SPBC27B12.11c |||transcription factor |Schizosaccharomyces pombe... 25 8.9 >SPAC1D4.02c |||human GRASP protein homolog |Schizosaccharomyces pombe|chr 1|||Manual Length = 345 Score = 25.8 bits (54), Expect = 5.1 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -3 Query: 96 RVVLVPPAPHGGATVDVGCGXGH 28 R V + P H G +GCG GH Sbjct: 182 RQVTIVPNRHWGGNGAIGCGVGH 204 >SPBC27B12.11c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 738 Score = 25.0 bits (52), Expect = 8.9 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +2 Query: 5 DAARLV**CPXPHPTSTVAPPCGAGGTNTTRR 100 D A L C P P T PP G+ G+ + R Sbjct: 221 DGAPLQRVCSAPDPPKTSMPPFGSAGSPSPNR 252 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,017,907 Number of Sequences: 5004 Number of extensions: 34083 Number of successful extensions: 91 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 275671126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -