BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0765 (561 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 3.0 AF457560-1|AAL68790.1| 56|Anopheles gambiae hypothetical prote... 23 6.8 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 3.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 484 PFCASLSRCTXGFEGQWXEN 543 P C S SR T F QW N Sbjct: 559 PLCGSASRQTQTFTSQWYLN 578 >AF457560-1|AAL68790.1| 56|Anopheles gambiae hypothetical protein 13 protein. Length = 56 Score = 23.0 bits (47), Expect = 6.8 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +1 Query: 67 LPNLNWAAFVISLITCIVIALNNELLKPWVSKRS 168 + N+ +A ++ L+ C+V NE+++ V KRS Sbjct: 1 MKNVFFALLLVVLVCCLVSVQGNEIIQN-VVKRS 33 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 541,667 Number of Sequences: 2352 Number of extensions: 10257 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -