BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0765 (561 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 23 2.1 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 2.8 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 8.5 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 8.5 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 8.5 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 8.5 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 8.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 8.5 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 8.5 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 8.5 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 23.0 bits (47), Expect = 2.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 325 TCGISSMAGTCGTGRPVGIC 266 +CG++ + TC GR IC Sbjct: 256 SCGVADLIATCYGGRNRKIC 275 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.6 bits (46), Expect = 2.8 Identities = 16/57 (28%), Positives = 24/57 (42%) Frame = +1 Query: 91 FVISLITCIVIALNNELLKPWVSKRSRVPVPVELLAIVVGTLVSKFGGLKEQFGIVW 261 FV ++ITCIVI W + + P L + V L+ GL + + W Sbjct: 48 FVGNIITCIVI---------WRNPSMQTPTNYYLFNLAVSDLLFLILGLPFELSVFW 95 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +1 Query: 151 WVSKRSRVPVPVELL 195 W+ +RSR+ PV + Sbjct: 443 WIDRRSRIVFPVAFI 457 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.0 bits (42), Expect = 8.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 172 VPVPVELLAIVVGTLVSKFGGLK 240 +P V LL + TLV+ F GLK Sbjct: 228 IPGRVALLVTSMLTLVTMFTGLK 250 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 139 LLKPWVSKRSRVP 177 +++PWV R +VP Sbjct: 105 MVRPWVPMRGQVP 117 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 139 LLKPWVSKRSRVP 177 +++PWV R +VP Sbjct: 105 MVRPWVPMRGQVP 117 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 139 LLKPWVSKRSRVP 177 +++PWV R +VP Sbjct: 105 MVRPWVPMRGQVP 117 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 139 LLKPWVSKRSRVP 177 +++PWV R +VP Sbjct: 105 MVRPWVPMRGQVP 117 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 139 LLKPWVSKRSRVP 177 +++PWV R +VP Sbjct: 105 MVRPWVPMRGQVP 117 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 139 LLKPWVSKRSRVP 177 +++PWV R +VP Sbjct: 105 MVRPWVPMRGQVP 117 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 139 LLKPWVSKRSRVP 177 +++PWV R +VP Sbjct: 105 MVRPWVPMRGQVP 117 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 139 LLKPWVSKRSRVP 177 +++PWV R +VP Sbjct: 354 MVRPWVPMRGQVP 366 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 139 LLKPWVSKRSRVP 177 +++PWV R +VP Sbjct: 354 MVRPWVPMRGQVP 366 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 139 LLKPWVSKRSRVP 177 +++PWV R +VP Sbjct: 354 MVRPWVPMRGQVP 366 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 139 LLKPWVSKRSRVP 177 +++PWV R +VP Sbjct: 354 MVRPWVPMRGQVP 366 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 139 LLKPWVSKRSRVP 177 +++PWV R +VP Sbjct: 354 MVRPWVPMRGQVP 366 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 139 LLKPWVSKRSRVP 177 +++PWV R +VP Sbjct: 354 MVRPWVPMRGQVP 366 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 139 LLKPWVSKRSRVP 177 +++PWV R +VP Sbjct: 353 MVRPWVPMRGQVP 365 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.0 bits (42), Expect = 8.5 Identities = 9/46 (19%), Positives = 21/46 (45%) Frame = +3 Query: 318 PQVAVDAFTITMVTYTISMSMALIFAAKEKYEIDANQELLALGASN 455 P+V +DA T +Y + + + + K+ + ++ L + N Sbjct: 277 PEVWIDAVTQIFFSYALGLGALVALGSYNKFNNNVYKDALIVCTVN 322 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.0 bits (42), Expect = 8.5 Identities = 9/46 (19%), Positives = 21/46 (45%) Frame = +3 Query: 318 PQVAVDAFTITMVTYTISMSMALIFAAKEKYEIDANQELLALGASN 455 P+V +DA T +Y + + + + K+ + ++ L + N Sbjct: 330 PEVWIDAVTQIFFSYALGLGALVALGSYNKFNNNVYKDALIVCTVN 375 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 139 LLKPWVSKRSRVP 177 +++PWV R +VP Sbjct: 338 MVRPWVPMRGQVP 350 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 139 LLKPWVSKRSRVP 177 +++PWV R +VP Sbjct: 354 MVRPWVPMRGQVP 366 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,258 Number of Sequences: 438 Number of extensions: 3351 Number of successful extensions: 26 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -