BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0761 (788 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g12210.1 68414.m01413 disease resistance protein (CC-NBS-LRR ... 48 9e-06 At5g16000.1 68418.m01871 leucine-rich repeat family protein / pr... 47 2e-05 At3g53590.1 68416.m05919 leucine-rich repeat transmembrane prote... 45 5e-05 At1g13230.1 68414.m01535 leucine-rich repeat family protein cont... 44 9e-05 At1g62950.1 68414.m07108 leucine-rich repeat transmembrane prote... 44 1e-04 At2g16250.1 68415.m01861 leucine-rich repeat transmembrane prote... 44 2e-04 At5g12940.1 68418.m01484 leucine-rich repeat family protein cont... 43 2e-04 At4g20940.1 68417.m03034 leucine-rich repeat family protein cont... 43 3e-04 At3g25670.1 68416.m03195 leucine-rich repeat family protein cont... 43 3e-04 At5g45780.1 68418.m05630 leucine-rich repeat transmembrane prote... 42 4e-04 At5g01890.1 68418.m00108 leucine-rich repeat transmembrane prote... 42 4e-04 At1g56140.1 68414.m06446 leucine-rich repeat family protein / pr... 42 5e-04 At4g30520.1 68417.m04333 leucine-rich repeat family protein / pr... 42 6e-04 At4g18760.1 68417.m02772 leucine-rich repeat family protein cont... 42 6e-04 At4g04220.1 68417.m00598 disease resistance family protein conta... 42 6e-04 At3g50230.1 68416.m05493 leucine-rich repeat transmembrane prote... 42 6e-04 At3g12610.1 68416.m01570 DNA-damage-repair/toleration protein, p... 42 6e-04 At5g01950.1 68418.m00114 leucine-rich repeat transmembrane prote... 41 8e-04 At2g17440.1 68415.m02012 leucine-rich repeat family protein cont... 41 8e-04 At1g06840.1 68414.m00729 leucine-rich repeat transmembrane prote... 41 0.001 At4g20140.1 68417.m02947 leucine-rich repeat transmembrane prote... 40 0.002 At2g42800.1 68415.m05299 leucine-rich repeat family protein cont... 40 0.002 At5g06940.1 68418.m00784 leucine-rich repeat family protein cont... 40 0.002 At1g07390.1 68414.m00788 leucine-rich repeat family protein cont... 40 0.002 At5g63710.1 68418.m07997 leucine-rich repeat transmembrane prote... 39 0.003 At1g28440.1 68414.m03496 leucine-rich repeat transmembrane prote... 39 0.003 At5g62230.1 68418.m07814 leucine-rich repeat family protein / pr... 39 0.004 At5g05160.1 68418.m00549 leucine-rich repeat transmembrane prote... 39 0.004 At3g28040.1 68416.m03500 leucine-rich repeat transmembrane prote... 39 0.004 At5g45770.1 68418.m05627 leucine-rich repeat family protein cont... 38 0.006 At2g35620.1 68415.m04368 leucine-rich repeat transmembrane prote... 38 0.008 At4g35470.1 68417.m05041 leucine-rich repeat family protein simi... 38 0.010 At4g28490.1 68417.m04076 leucine-rich repeat transmembrane prote... 38 0.010 At3g57830.1 68416.m06447 leucine-rich repeat transmembrane prote... 38 0.010 At3g15410.1 68416.m01955 leucine-rich repeat family protein cont... 38 0.010 At2g27060.1 68415.m03251 leucine-rich repeat transmembrane prote... 38 0.010 At1g34110.1 68414.m04230 leucine-rich repeat transmembrane prote... 38 0.010 At1g33600.1 68414.m04159 leucine-rich repeat family protein cont... 38 0.010 At5g44700.1 68418.m05477 leucine-rich repeat transmembrane prote... 37 0.013 At3g11330.1 68416.m01378 leucine-rich repeat family protein 37 0.013 At1g08590.1 68414.m00952 CLAVATA1 receptor kinase (CLV1) similar... 37 0.013 At5g48940.1 68418.m06054 leucine-rich repeat transmembrane prote... 37 0.018 At5g19680.1 68418.m02341 leucine-rich repeat family protein cont... 37 0.018 At4g39270.2 68417.m05561 leucine-rich repeat transmembrane prote... 37 0.018 At4g39270.1 68417.m05562 leucine-rich repeat transmembrane prote... 37 0.018 At4g36180.1 68417.m05148 leucine-rich repeat family protein cont... 37 0.018 At4g26050.1 68417.m03750 leucine-rich repeat family protein cont... 37 0.018 At5g10020.1 68418.m01161 leucine-rich repeat transmembrane prote... 36 0.023 At2g26330.1 68415.m03159 leucine-rich repeat protein kinase, put... 36 0.023 At2g02220.1 68415.m00159 leucine-rich repeat transmembrane prote... 36 0.023 At1g75820.1 68414.m08807 CLAVATA1 receptor kinase (CLV1) identic... 36 0.023 At1g71400.1 68414.m08246 disease resistance family protein / LRR... 36 0.023 At1g64210.1 68414.m07274 leucine-rich repeat transmembrane prote... 36 0.023 At5g05850.1 68418.m00643 leucine-rich repeat family protein cont... 36 0.031 At1g75640.1 68414.m08788 leucine-rich repeat family protein / pr... 36 0.031 At1g73080.1 68414.m08450 leucine-rich repeat transmembrane prote... 36 0.031 At1g56145.1 68414.m06448 leucine-rich repeat family protein / pr... 36 0.031 At1g28340.1 68414.m03481 leucine-rich repeat family protein cont... 36 0.031 At5g56040.1 68418.m06992 leucine-rich repeat protein kinase, put... 36 0.040 At3g19700.1 68416.m02495 leucine-rich repeat transmembrane prote... 36 0.040 At2g34930.1 68415.m04288 disease resistance family protein conta... 36 0.040 At1g60800.1 68414.m06844 leucine-rich repeat family protein / pr... 36 0.040 At1g56120.1 68414.m06444 leucine-rich repeat family protein / pr... 36 0.040 At5g53890.1 68418.m06703 leucine-rich repeat transmembrane prote... 35 0.054 At4g20270.1 68417.m02961 leucine-rich repeat transmembrane prote... 35 0.054 At3g23120.1 68416.m02914 leucine-rich repeat family protein cont... 35 0.054 At3g20820.1 68416.m02633 leucine-rich repeat family protein cont... 35 0.054 At2g33030.1 68415.m04049 leucine-rich repeat family protein cont... 35 0.054 At1g74360.1 68414.m08615 leucine-rich repeat transmembrane prote... 35 0.054 At5g67280.1 68418.m08483 leucine-rich repeat transmembrane prote... 35 0.071 At5g65240.1 68418.m08207 leucine-rich repeat family protein / pr... 35 0.071 At5g40170.1 68418.m04875 disease resistance family protein conta... 35 0.071 At5g21090.1 68418.m02511 leucine-rich repeat protein, putative s... 35 0.071 At3g43740.1 68416.m04672 leucine-rich repeat family protein cont... 35 0.071 At3g25010.1 68416.m03126 disease resistance family protein conta... 35 0.071 At3g24240.1 68416.m03042 leucine-rich repeat transmembrane prote... 35 0.071 At2g33060.1 68415.m04054 leucine-rich repeat family protein cont... 35 0.071 At2g25470.1 68415.m03050 leucine-rich repeat family protein cont... 35 0.071 At1g73070.1 68414.m08449 leucine-rich repeat family protein cont... 35 0.071 At4g37250.1 68417.m05273 leucine-rich repeat family protein / pr... 34 0.094 At3g47110.1 68416.m05115 leucine-rich repeat transmembrane prote... 34 0.094 At3g26500.1 68416.m03305 leucine-rich repeat family protein 34 0.094 At3g05360.1 68416.m00584 disease resistance family protein / LRR... 34 0.094 At2g24230.1 68415.m02894 leucine-rich repeat transmembrane prote... 34 0.094 At2g23300.1 68415.m02781 leucine-rich repeat transmembrane prote... 34 0.094 At1g56130.1 68414.m06445 leucine-rich repeat family protein / pr... 34 0.094 At5g46330.1 68418.m05703 leucine-rich repeat transmembrane prote... 34 0.12 At5g20480.1 68418.m02434 leucine-rich repeat transmembrane prote... 34 0.12 At4g22730.1 68417.m03279 leucine-rich repeat transmembrane prote... 34 0.12 At3g59510.1 68416.m06641 leucine-rich repeat family protein cont... 34 0.12 At2g23950.1 68415.m02860 leucine-rich repeat family protein / pr... 34 0.12 At5g67200.1 68418.m08471 leucine-rich repeat transmembrane prote... 33 0.16 At4g26540.1 68417.m03823 protein kinase family protein Three fal... 33 0.16 At4g03260.1 68417.m00445 leucine-rich repeat family protein cont... 33 0.16 At3g51740.1 68416.m05673 leucine-rich repeat transmembrane prote... 33 0.16 At3g02130.1 68416.m00180 leucine-rich repeat transmembrane prote... 33 0.16 At2g32660.1 68415.m03992 disease resistance family protein / LRR... 33 0.16 At1g74180.1 68414.m08591 leucine-rich repeat family protein cont... 33 0.16 At1g12460.1 68414.m01440 leucine-rich repeat transmembrane prote... 33 0.16 At5g58150.1 68418.m07278 leucine-rich repeat transmembrane prote... 33 0.22 At5g07180.1 68418.m00818 leucine-rich repeat family protein / pr... 33 0.22 At3g56100.1 68416.m06235 leucine-rich repeat transmembrane prote... 33 0.22 At3g47580.1 68416.m05180 leucine-rich repeat transmembrane prote... 33 0.22 At2g15080.2 68415.m01719 disease resistance family protein conta... 33 0.22 At2g15080.1 68415.m01718 disease resistance family protein conta... 33 0.22 At1g13910.1 68414.m01632 leucine-rich repeat family protein cont... 33 0.22 At5g51350.1 68418.m06367 leucine-rich repeat transmembrane prote... 33 0.29 At5g49780.1 68418.m06165 leucine-rich repeat transmembrane prote... 33 0.29 At5g37450.1 68418.m04507 leucine-rich repeat transmembrane prote... 33 0.29 At3g25560.1 68416.m03178 protein kinase family protein contains ... 33 0.29 At3g25020.1 68416.m03127 disease resistance family protein conta... 33 0.29 At3g05370.1 68416.m00586 disease resistance family protein conta... 33 0.29 At2g42290.1 68415.m05235 leucine-rich repeat family protein cont... 33 0.29 At2g15320.1 68415.m01747 leucine-rich repeat family protein cont... 33 0.29 At2g15300.1 68415.m01745 leucine-rich repeat transmembrane prote... 33 0.29 At1g71830.1 68414.m08301 leucine-rich repeat family protein / pr... 33 0.29 At1g61310.1 68414.m06910 disease resistance protein (CC-NBS-LRR ... 33 0.29 At1g17250.1 68414.m02101 leucine-rich repeat family protein cont... 33 0.29 At5g65710.1 68418.m08270 leucine-rich repeat transmembrane prote... 32 0.38 At5g49660.1 68418.m06147 leucine-rich repeat transmembrane prote... 32 0.38 At5g14210.1 68418.m01660 leucine-rich repeat transmembrane prote... 32 0.38 At4g08850.2 68417.m01455 leucine-rich repeat family protein / pr... 32 0.38 At4g08850.1 68417.m01454 leucine-rich repeat family protein / pr... 32 0.38 At3g53720.1 68416.m05934 cation/hydrogen exchanger, putative (CH... 32 0.38 At2g30100.1 68415.m03663 ubiquitin family protein low similarity... 32 0.38 At2g26380.1 68415.m03166 disease resistance protein-related / LR... 32 0.38 At1g68780.1 68414.m07862 leucine-rich repeat family protein cont... 32 0.38 At1g65380.1 68414.m07417 receptor-like protein CLAVATA2 (CLV2) i... 32 0.38 At5g61240.1 68418.m07681 leucine-rich repeat family protein cont... 32 0.50 At5g49290.1 68418.m06100 leucine-rich repeat family protein cont... 32 0.50 At5g25910.1 68418.m03077 disease resistance family protein conta... 32 0.50 At5g07280.1 68418.m00830 leucine-rich repeat protein kinase, put... 32 0.50 At3g47090.1 68416.m05113 leucine-rich repeat transmembrane prote... 32 0.50 At3g24900.1 68416.m03122 disease resistance family protein / LRR... 32 0.50 At2g33080.1 68415.m04056 leucine-rich repeat family protein cont... 32 0.50 At2g31880.1 68415.m03895 leucine-rich repeat transmembrane prote... 32 0.50 At1g71390.1 68414.m08243 disease resistance family protein / LRR... 32 0.50 At1g35710.1 68414.m04439 leucine-rich repeat transmembrane prote... 32 0.50 At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr... 32 0.50 At1g09970.2 68414.m01124 leucine-rich repeat transmembrane prote... 32 0.50 At1g09970.1 68414.m01123 leucine-rich repeat transmembrane prote... 32 0.50 At5g48740.1 68418.m06032 leucine-rich repeat family protein / pr... 31 0.66 At2g25790.1 68415.m03095 leucine-rich repeat transmembrane prote... 31 0.66 At2g25440.1 68415.m03047 leucine-rich repeat family protein cont... 31 0.66 At2g24130.1 68415.m02883 leucine-rich repeat transmembrane prote... 31 0.66 At1g58190.1 68414.m06605 leucine-rich repeat family protein cont... 31 0.66 At1g55610.1 68414.m06365 protein kinase family protein contains ... 31 0.66 At1g07650.1 68414.m00821 leucine-rich repeat transmembrane prote... 31 0.66 At5g61480.1 68418.m07714 leucine-rich repeat transmembrane prote... 31 0.87 At5g27060.1 68418.m03229 disease resistance family protein conta... 31 0.87 At4g19470.1 68417.m02864 disease resistance protein-related simi... 31 0.87 At3g43740.2 68416.m04673 leucine-rich repeat family protein cont... 31 0.87 At2g13790.1 68415.m01522 leucine-rich repeat family protein / pr... 31 0.87 At1g45616.1 68414.m05200 leucine-rich repeat family protein cont... 31 0.87 At5g23400.1 68418.m02739 disease resistance family protein / LRR... 31 1.2 At4g33430.1 68417.m04750 brassinosteroid insensitive 1-associate... 31 1.2 At3g24954.1 68416.m03124 leucine-rich repeat family protein cont... 31 1.2 At2g33170.1 68415.m04064 leucine-rich repeat transmembrane prote... 31 1.2 At2g33050.1 68415.m04053 leucine-rich repeat family protein cont... 31 1.2 At2g33020.1 68415.m04047 leucine-rich repeat family protein cont... 31 1.2 At2g01820.1 68415.m00113 leucine-rich repeat protein kinase, put... 31 1.2 At1g53730.1 68414.m06114 leucine-rich repeat transmembrane prote... 31 1.2 At1g33670.1 68414.m04165 leucine-rich repeat family protein cont... 31 1.2 At5g63930.1 68418.m08028 leucine-rich repeat transmembrane prote... 30 1.5 At5g59650.1 68418.m07479 leucine-rich repeat protein kinase, put... 30 1.5 At5g45840.1 68418.m05639 leucine-rich repeat transmembrane prote... 30 1.5 At4g28650.1 68417.m04095 leucine-rich repeat transmembrane prote... 30 1.5 At3g56370.1 68416.m06269 leucine-rich repeat transmembrane prote... 30 1.5 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 30 1.5 At3g11010.1 68416.m01329 disease resistance family protein / LRR... 30 1.5 At3g03770.1 68416.m00383 leucine-rich repeat transmembrane prote... 30 1.5 At2g32680.1 68415.m03995 disease resistance family protein conta... 30 1.5 At2g20850.1 68415.m02457 leucine-rich repeat protein kinase, put... 30 1.5 At1g62630.1 68414.m07066 disease resistance protein (CC-NBS-LRR ... 30 1.5 At1g47890.1 68414.m05333 disease resistance family protein conta... 30 1.5 At1g33610.1 68414.m04160 leucine-rich repeat family protein cont... 30 1.5 At1g09760.1 68414.m01095 U2 small nuclear ribonucleoprotein A, p... 30 1.5 At4g39400.1 68417.m05577 brassinosteroid insensitive 1 (BRI1) id... 30 2.0 At4g13820.1 68417.m02141 disease resistance family protein / LRR... 30 2.0 At3g14460.1 68416.m01832 disease resistance protein (NBS-LRR cla... 30 2.0 At2g34680.1 68415.m04260 leucine-rich repeat family protein cont... 30 2.0 At1g61190.1 68414.m06895 disease resistance protein (CC-NBS-LRR ... 30 2.0 At5g49770.1 68418.m06164 leucine-rich repeat transmembrane prote... 29 2.7 At4g28560.1 68417.m04085 leucine-rich repeat family protein (fra... 29 2.7 At4g28380.1 68417.m04062 leucine-rich repeat family protein cont... 29 2.7 At4g16940.1 68417.m02555 disease resistance protein (TIR-NBS-LRR... 29 2.7 At4g13920.1 68417.m02154 disease resistance family protein / LRR... 29 2.7 At3g08680.2 68416.m01009 leucine-rich repeat transmembrane prote... 29 2.7 At3g08680.1 68416.m01008 leucine-rich repeat transmembrane prote... 29 2.7 At2g28970.1 68415.m03524 leucine-rich repeat protein kinase, put... 29 2.7 At2g02060.1 68415.m00141 calcium-dependent protein kinase-relate... 29 2.7 At1g74190.1 68414.m08592 leucine-rich repeat family protein cont... 29 2.7 At1g33590.1 68414.m04158 disease resistance protein-related / LR... 29 2.7 At1g27170.1 68414.m03310 disease resistance protein (TIR-NBS-LRR... 29 2.7 At1g17750.1 68414.m02197 leucine-rich repeat transmembrane prote... 29 2.7 At4g23740.1 68417.m03415 leucine-rich repeat transmembrane prote... 29 3.5 At4g13810.1 68417.m02140 disease resistance family protein / LRR... 29 3.5 At3g49750.1 68416.m05439 leucine-rich repeat family protein cont... 29 3.5 At3g43190.1 68416.m04558 sucrose synthase, putative / sucrose-UD... 29 3.5 At3g23110.1 68416.m02913 disease resistance family protein conta... 29 3.5 At3g11080.1 68416.m01339 disease resistance family protein conta... 29 3.5 At1g80080.1 68414.m09374 leucine-rich repeat family protein cont... 29 3.5 At1g74200.1 68414.m08594 leucine-rich repeat family protein cont... 29 3.5 At1g65540.1 68414.m07435 calcium-binding EF hand family protein ... 29 3.5 At1g61300.1 68414.m06909 disease resistance protein (NBS-LRR cla... 29 3.5 At1g34210.1 68414.m04245 somatic embryogenesis receptor-like kin... 29 3.5 At1g31420.1 68414.m03848 leucine-rich repeat transmembrane prote... 29 3.5 At3g16300.1 68416.m02057 integral membrane family protein contai... 29 4.6 At2g26730.1 68415.m03206 leucine-rich repeat transmembrane prote... 29 4.6 At2g13800.1 68415.m01523 leucine-rich repeat family protein / pr... 29 4.6 At2g01950.1 68415.m00130 leucine-rich repeat transmembrane prote... 29 4.6 At5g65700.1 68418.m08269 leucine-rich repeat transmembrane prote... 28 6.1 At5g63410.1 68418.m07960 leucine-rich repeat transmembrane prote... 28 6.1 At5g62710.1 68418.m07869 leucine-rich repeat family protein / pr... 28 6.1 At5g06870.1 68418.m00777 polygalacturonase inhibiting protein 2 ... 28 6.1 At4g16950.2 68417.m02557 disease resistance protein (TIR-NBS-LRR... 28 6.1 At4g16950.1 68417.m02556 disease resistance protein (TIR-NBS-LRR... 28 6.1 At4g16920.1 68417.m02552 disease resistance protein (TIR-NBS-LRR... 28 6.1 At3g46350.1 68416.m05020 leucine-rich repeat protein kinase, put... 28 6.1 At3g28890.1 68416.m03606 leucine-rich repeat family protein cont... 28 6.1 At3g14350.3 68416.m01816 leucine-rich repeat transmembrane prote... 28 6.1 At3g14350.2 68416.m01814 leucine-rich repeat transmembrane prote... 28 6.1 At3g14350.1 68416.m01815 leucine-rich repeat transmembrane prote... 28 6.1 At3g13380.1 68416.m01683 leucine-rich repeat family protein / pr... 28 6.1 At2g41820.1 68415.m05168 leucine-rich repeat transmembrane prote... 28 6.1 At1g72180.1 68414.m08346 leucine-rich repeat transmembrane prote... 28 6.1 At1g34420.1 68414.m04275 leucine-rich repeat family protein / pr... 28 6.1 At1g29750.2 68414.m03638 leucine-rich repeat transmembrane prote... 28 6.1 At1g29750.1 68414.m03637 leucine-rich repeat transmembrane prote... 28 6.1 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 28 6.1 At5g58300.1 68418.m07298 leucine-rich repeat transmembrane prote... 28 8.1 At5g49760.1 68418.m06163 leucine-rich repeat family protein / pr... 28 8.1 At5g25930.1 68418.m03081 leucine-rich repeat family protein / pr... 28 8.1 At4g29450.1 68417.m04204 leucine-rich repeat protein kinase, put... 28 8.1 At4g13880.1 68417.m02150 leucine-rich repeat family protein cont... 28 8.1 At3g53240.1 68416.m05868 leucine-rich repeat family protein cont... 28 8.1 At3g46330.1 68416.m05017 leucine-rich repeat protein kinase, put... 28 8.1 At3g13065.1 68416.m01632 leucine-rich repeat transmembrane prote... 28 8.1 At2g14440.1 68415.m01616 leucine-rich repeat protein kinase, put... 28 8.1 >At1g12210.1 68414.m01413 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 885 Score = 47.6 bits (108), Expect = 9e-06 Identities = 34/94 (36%), Positives = 54/94 (57%), Gaps = 2/94 (2%) Frame = +1 Query: 253 HRLVTFEPETFEPLSSLKILSL-RNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGL 429 ++LV E F + SL +L L N+S+ ++P + ++ L+YLDLS I+++ HGL Sbjct: 549 YKLVDISMEFFRCMPSLAVLDLSENHSLSELPE-EISELVSLQYLDLSGTYIERLP-HGL 606 Query: 430 PFLKELKHLDL-NNNIIESVDSIRFS*LPSLRHL 528 L++L HL L +ES+ I + L SLR L Sbjct: 607 HELRKLVHLKLERTRRLESISGISY--LSSLRTL 638 >At5g16000.1 68418.m01871 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 638 Score = 46.8 bits (106), Expect = 2e-05 Identities = 27/79 (34%), Positives = 44/79 (55%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L++L+I+ L+NN+I A +G + LE LDLS+N + +L+ L++L LNNN Sbjct: 104 LTNLRIVLLQNNNIKGKIPAEIGRLTRLETLDLSDNFFHGEIPFSVGYLQSLQYLRLNNN 163 Query: 472 IIESVDSIRFS*LPSLRHL 528 + V + S + L L Sbjct: 164 SLSGVFPLSLSNMTQLAFL 182 Score = 28.7 bits (61), Expect = 4.6 Identities = 19/66 (28%), Positives = 32/66 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P L+ L+ L L +N ++G++ L+YL L+ N + V L + +L Sbjct: 122 PAEIGRLTRLETLDLSDNFFHGEIPFSVGYLQSLQYLRLNNNSLSGVFPLSLSNMTQLAF 181 Query: 454 LDLNNN 471 LDL+ N Sbjct: 182 LDLSYN 187 >At3g53590.1 68416.m05919 leucine-rich repeat transmembrane protein kinase, putative CLV1 receptor kinase, Arabidopsis thaliana, EMBL:ATU96879 Length = 783 Score = 45.2 bits (102), Expect = 5e-05 Identities = 28/79 (35%), Positives = 37/79 (46%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 +SSLK+L L N LG + +L L + EN I L+ +KHL LNNN Sbjct: 16 ISSLKLLLLNGNKFTGSLPPELGNLQNLNRLQVDENNITGSVPFSFGNLRSIKHLHLNNN 75 Query: 472 IIESVDSIRFS*LPSLRHL 528 I + S LP L H+ Sbjct: 76 TISGEIPVELSKLPKLVHM 94 Score = 29.5 bits (63), Expect = 2.7 Identities = 22/82 (26%), Positives = 37/82 (45%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P L +L L + N+I + G + +++L L+ N I L L +L H Sbjct: 34 PPELGNLQNLNRLQVDENNITGSVPFSFGNLRSIKHLHLNNNTISGEIPVELSKLPKLVH 93 Query: 454 LDLNNNIIESVDSIRFS*LPSL 519 + L+NN + + + LPSL Sbjct: 94 MILDNNNLTGTLPLELAQLPSL 115 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSI 333 P++F L+SL++LSL NNS+ Sbjct: 201 PQSFSDLNSLQLLSLENNSL 220 >At1g13230.1 68414.m01535 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to gb|U42445 Cf-2.2 from Lycopersicon pimpinellifolium Length = 424 Score = 44.4 bits (100), Expect = 9e-05 Identities = 27/66 (40%), Positives = 33/66 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P F+ L L IL L NS + G ++ L LDLS NL++ L FLK L Sbjct: 208 PNCFKGLKELLILDLSRNSFSGTLPTSFGDLVSLLKLDLSNNLLEGNLPQELGFLKNLTL 267 Query: 454 LDLNNN 471 LDL NN Sbjct: 268 LDLRNN 273 Score = 33.1 bits (72), Expect = 0.22 Identities = 29/84 (34%), Positives = 41/84 (48%), Gaps = 3/84 (3%) Frame = +1 Query: 277 ETFEPLSSLKILSLRNNSI--LDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 + E + SL L L NN + D+ N G + +L LDLS+ ++ L LK L+ Sbjct: 281 KNIENIQSLTELVLSNNPMGEEDMVGTNWGKMSNLVVLDLSKMGLRGEIPTSLTNLKRLR 340 Query: 451 HLDLNNNIIES-VDSIRFS*LPSL 519 L LNNN + V S + LP L Sbjct: 341 FLGLNNNNLTGFVPSKKLEALPCL 364 Score = 32.7 bits (71), Expect = 0.29 Identities = 23/74 (31%), Positives = 33/74 (44%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P +F L SL L L NN + LGF+ +L LDL N + ++ L Sbjct: 232 PTSFGDLVSLLKLDLSNNLLEGNLPQELGFLKNLTLLDLRNNRFSGGLSKNIENIQSLTE 291 Query: 454 LDLNNNIIESVDSI 495 L L+NN + D + Sbjct: 292 LVLSNNPMGEEDMV 305 >At1g62950.1 68414.m07108 leucine-rich repeat transmembrane protein kinase, putative contains protein kinase domains Length = 890 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/71 (33%), Positives = 38/71 (53%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+ L++L+IL L N I NLG + +++LDLSENL+ L LK L H Sbjct: 402 PKNLLNLTNLEILDLHRNRISGNIPPNLGSLSRIQFLDLSENLLSGPIPSSLENLKRLTH 461 Query: 454 LDLNNNIIESV 486 +++ N + + Sbjct: 462 FNVSYNNLSGI 472 >At2g16250.1 68415.m01861 leucine-rich repeat transmembrane protein kinase, putative Length = 915 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/68 (35%), Positives = 38/68 (55%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P T L+SL+ L+L NS+ + ++LG +++L LDLS N V LK L Sbjct: 145 PFTLGNLTSLRTLNLSQNSLTSLVPSSLGQLLNLSQLDLSRNSFTGVLPQSFSSLKNLLT 204 Query: 454 LDLNNNII 477 LD+++N + Sbjct: 205 LDVSSNYL 212 Score = 34.3 bits (75), Expect = 0.094 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = +1 Query: 274 PETFE-PLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 PE F L +L++L L + S+ + LG + L L+LS+N + + L L L Sbjct: 120 PEWFGVSLLALEVLDLSSCSVNGVVPFTLGNLTSLRTLNLSQNSLTSLVPSSLGQLLNLS 179 Query: 451 HLDLNNNIIESVDSIRFS*LPSL 519 LDL+ N V FS L +L Sbjct: 180 QLDLSRNSFTGVLPQSFSSLKNL 202 >At5g12940.1 68418.m01484 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 371 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/71 (35%), Positives = 36/71 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P E L L+ L L N + AN+G ++ L+ L+L++N + V + L L H Sbjct: 127 PSCIENLPFLRHLDLVGNKFSGVIPANIGKLLRLKVLNLADNHLYGVIPPSITRLVSLSH 186 Query: 454 LDLNNNIIESV 486 LDL NN I V Sbjct: 187 LDLRNNNISGV 197 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P L LK+L+L +N + + ++ ++ L +LDL N I V + LK + Sbjct: 151 PANIGKLLRLKVLNLADNHLYGVIPPSITRLVSLSHLDLRNNNISGVIPRDIGRLKMVSR 210 Query: 454 LDLNNNII 477 + L+ N I Sbjct: 211 VLLSGNKI 218 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPF 435 P TF P S +L L NN + A++ + +LD+S N + G PF Sbjct: 294 PNTFGPRSYFTVLDLANNRLQGPIPASITAASFIGHLDVSHNHLCGKIPMGSPF 347 >At4g20940.1 68417.m03034 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to leucine-rich repeat receptor-like protein kinase INRPK1 [Ipomoea nil] gi|14495542|gb|AAB36558 Length = 977 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKE-LK 450 P FE +SSL++L L NSI + + Y+D+S N + S LP + E +K Sbjct: 191 PRGFELISSLEVLDLHGNSIDGNLDGEFFLLTNASYVDISGNRLVTTSGKLLPGVSESIK 250 Query: 451 HLDLNNNIIE 480 HL+L++N +E Sbjct: 251 HLNLSHNQLE 260 Score = 35.5 bits (78), Expect = 0.040 Identities = 21/63 (33%), Positives = 33/63 (52%) Frame = +1 Query: 283 FEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDL 462 F L+ L LS+ NNS+ + +LG L++LDLS+NL + L++L L Sbjct: 74 FSNLTKLVKLSMSNNSLSGVLPNDLGSFKSLQFLDLSDNLFSSSLPKEIGRSVSLRNLSL 133 Query: 463 NNN 471 + N Sbjct: 134 SGN 136 Score = 32.7 bits (71), Expect = 0.29 Identities = 22/69 (31%), Positives = 34/69 (49%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L SL+ L + +NS+ +L + L YL+LS N G + L+ Sbjct: 143 PESMGGLISLQSLDMSSNSLSGPLPKSLTRLNDLLYLNLSSNGFTGKMPRGFELISSLEV 202 Query: 454 LDLNNNIIE 480 LDL+ N I+ Sbjct: 203 LDLHGNSID 211 Score = 31.5 bits (68), Expect = 0.66 Identities = 19/58 (32%), Positives = 32/58 (55%) Frame = +1 Query: 298 SLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 SL+ LSL N+ ++G +I L+ LD+S N + L L +L +L+L++N Sbjct: 127 SLRNLSLSGNNFSGEIPESMGGLISLQSLDMSSNSLSGPLPKSLTRLNDLLYLNLSSN 184 >At3g25670.1 68416.m03195 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; + Length = 475 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/85 (34%), Positives = 39/85 (45%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+ F L IL + NS I ++G ++ L LDLS N ++ + FLK L Sbjct: 204 PDCFNGFKDLLILDMSRNSFSGILPLSVGEMVSLLKLDLSNNQLEGRLPQEIGFLKNLTL 263 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 LDL NN I +PSL L Sbjct: 264 LDLRNNRISGGLFENIEKIPSLTDL 288 Score = 27.9 bits (59), Expect = 8.1 Identities = 29/87 (33%), Positives = 41/87 (47%), Gaps = 6/87 (6%) Frame = +1 Query: 277 ETFEPLSSLKILSLRNN-----SILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLK 441 E E + SL L L N ++ I N+G +L LDLS+ ++ GL L+ Sbjct: 277 ENIEKIPSLTDLVLSGNPMGSDDMMGIKWENMG---NLVILDLSKMGLRGEVPLGLTSLR 333 Query: 442 ELKHLDLN-NNIIESVDSIRFS*LPSL 519 L+ L LN NN+ +V S LP L Sbjct: 334 RLRFLGLNDNNLTGTVPSKELETLPCL 360 >At5g45780.1 68418.m05630 leucine-rich repeat transmembrane protein kinase, putative Length = 614 Score = 42.3 bits (95), Expect = 4e-04 Identities = 26/66 (39%), Positives = 32/66 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P LS L+ L L N A+LGF+ HL YL LS NL+ H + L L Sbjct: 120 PSELGQLSELETLDLSGNRFSGEIPASLGFLTHLNYLRLSRNLLSGQVPHLVAGLSGLSF 179 Query: 454 LDLNNN 471 LDL+ N Sbjct: 180 LDLSFN 185 Score = 34.7 bits (76), Expect = 0.071 Identities = 22/62 (35%), Positives = 31/62 (50%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L+ L L L+NN + + LG + LE LDLS N L FL L +L L+ N Sbjct: 102 LTHLHTLLLQNNQLTGPIPSELGQLSELETLDLSGNRFSGEIPASLGFLTHLNYLRLSRN 161 Query: 472 II 477 ++ Sbjct: 162 LL 163 >At5g01890.1 68418.m00108 leucine-rich repeat transmembrane protein kinase, putative leucine-rich receptor-like protein (LRPKm1) - Malus domestica, EMBL:AF053127 Length = 967 Score = 42.3 bits (95), Expect = 4e-04 Identities = 26/82 (31%), Positives = 40/82 (48%) Frame = +1 Query: 283 FEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDL 462 FE SL+ +SL NN + +L + L +L+LS N + + FLK LK LD Sbjct: 137 FEQCGSLRSVSLANNKLTGSIPVSLSYCSTLTHLNLSSNQLSGRLPRDIWFLKSLKSLDF 196 Query: 463 NNNIIESVDSIRFS*LPSLRHL 528 ++N ++ L LRH+ Sbjct: 197 SHNFLQGDIPDGLGGLYDLRHI 218 Score = 35.5 bits (78), Expect = 0.040 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 1/69 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 P++ + L S + LR NS++ +IP +G + LE LDLS N L L+ LK Sbjct: 254 PDSMKSLGSCSSIRLRGNSLIGEIPDW-IGDIATLEILDLSANNFTGTVPFSLGNLEFLK 312 Query: 451 HLDLNNNII 477 L+L+ N++ Sbjct: 313 DLNLSANML 321 Score = 30.7 bits (66), Expect = 1.2 Identities = 20/78 (25%), Positives = 37/78 (47%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L ++RL P S+L ++L N + ++G + +LEY+DLS N + Sbjct: 464 LHRNRLSGQIPAKISNCSALNTINLSENELSGAIPGSIGSLSNLEYIDLSRNNLSGSLPK 523 Query: 424 GLPFLKELKHLDLNNNII 477 + L L ++++N I Sbjct: 524 EIEKLSHLLTFNISHNNI 541 Score = 28.7 bits (61), Expect = 4.6 Identities = 20/66 (30%), Positives = 29/66 (43%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P L+SL L++ NS+ +G + E LDLS NL+ + LK Sbjct: 402 PSNIWILTSLLQLNMSTNSLFGSIPTGIGGLKVAEILDLSSNLLNGTLPSEIGGAVSLKQ 461 Query: 454 LDLNNN 471 L L+ N Sbjct: 462 LHLHRN 467 >At1g56140.1 68414.m06446 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1032 Score = 41.9 bits (94), Expect = 5e-04 Identities = 25/67 (37%), Positives = 35/67 (52%) Frame = +1 Query: 277 ETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHL 456 E + + SL IL LRNN++ +N+G L LDLS N + L L++L HL Sbjct: 283 EFIKDMKSLSILVLRNNNLTGTIPSNIGEYSSLRQLDLSFNKLHGTIPASLFNLRQLTHL 342 Query: 457 DLNNNII 477 L NN + Sbjct: 343 FLGNNTL 349 >At4g30520.1 68417.m04333 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 648 Score = 41.5 bits (93), Expect = 6e-04 Identities = 28/84 (33%), Positives = 42/84 (50%) Frame = +1 Query: 277 ETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHL 456 E+ L++L+ +SL+NN+I LGF+ L+ LDLS N + L L++L Sbjct: 95 ESIGNLTNLRQVSLQNNNISGKIPPELGFLPKLQTLDLSNNRFSGDIPVSIDQLSSLQYL 154 Query: 457 DLNNNIIESVDSIRFS*LPSLRHL 528 LNNN + S +P L L Sbjct: 155 RLNNNSLSGPFPASLSQIPHLSFL 178 Score = 36.3 bits (80), Expect = 0.023 Identities = 19/42 (45%), Positives = 26/42 (61%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 P + + LSSL+ L L NNS+ A+L + HL +LDLS N Sbjct: 142 PVSIDQLSSLQYLRLNNNSLSGPFPASLSQIPHLSFLDLSYN 183 Score = 28.7 bits (61), Expect = 4.6 Identities = 19/61 (31%), Positives = 30/61 (49%) Frame = +1 Query: 346 SANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNIIESVDSIRFS*LPSLRH 525 S ++G + +L + L N I L FL +L+ LDL+NN + L SL++ Sbjct: 94 SESIGNLTNLRQVSLQNNNISGKIPPELGFLPKLQTLDLSNNRFSGDIPVSIDQLSSLQY 153 Query: 526 L 528 L Sbjct: 154 L 154 >At4g18760.1 68417.m02772 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 431 Score = 41.5 bits (93), Expect = 6e-04 Identities = 30/86 (34%), Positives = 44/86 (51%), Gaps = 1/86 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 P + LS+LK L+L N+I DIP + +G +I L+ L LS N + + + EL Sbjct: 229 PTSITLLSNLKSLNLSKNTISGDIPDS-IGDLISLKNLSLSSNKLSGPIPDSISSIPELT 287 Query: 451 HLDLNNNIIESVDSIRFS*LPSLRHL 528 HLDL+ N + S + L HL Sbjct: 288 HLDLSGNQLNGTIPRFISKMKYLTHL 313 Score = 37.1 bits (82), Expect = 0.013 Identities = 23/71 (32%), Positives = 35/71 (49%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P++ L SLK LSL +N + ++ + L +LDLS N + + +K L H Sbjct: 253 PDSIGDLISLKNLSLSSNKLSGPIPDSISSIPELTHLDLSGNQLNGTIPRFISKMKYLTH 312 Query: 454 LDLNNNIIESV 486 L+L NN V Sbjct: 313 LNLANNAFHGV 323 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/56 (32%), Positives = 29/56 (51%) Frame = +1 Query: 361 FVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNIIESVDSIRFS*LPSLRHL 528 F +L ++DLS+NL++ + L LK L+L+ N I L SL++L Sbjct: 210 FHSNLTFIDLSDNLLKGSIPTSITLLSNLKSLNLSKNTISGDIPDSIGDLISLKNL 265 Score = 27.9 bits (59), Expect = 8.1 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +2 Query: 488 IQLGFHSCLHYVIWDLSDNNMT-LIPTSALSKLSNLSHLYLS 610 I FHS L ++ DLSDN + IPTS ++ LSNL L LS Sbjct: 206 IPKSFHSNLTFI--DLSDNLLKGSIPTS-ITLLSNLKSLNLS 244 >At4g04220.1 68417.m00598 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-2A [Lycopersicon pimpinellifolium] gi|3894389|gb|AAC78594 Length = 811 Score = 41.5 bits (93), Expect = 6e-04 Identities = 28/76 (36%), Positives = 38/76 (50%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L K++L P + L SLK+L+L NN + + G + +E LDLS N + Sbjct: 649 LSKNKLHGEIPTSLGNLKSLKVLNLSNNEFSGLIPQSFGDLEKVESLDLSHNNLTGEIPK 708 Query: 424 GLPFLKELKHLDLNNN 471 L L EL LDL NN Sbjct: 709 TLSKLSELNTLDLRNN 724 Score = 31.9 bits (69), Expect = 0.50 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +1 Query: 295 SSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 SS+++LSLRNNS+ + + L+ LDLSEN Sbjct: 537 SSVEVLSLRNNSLKGSIPEGISNLTSLKVLDLSEN 571 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/64 (29%), Positives = 31/64 (48%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L +L+ L L N I + +G ++ L L L +N+ + L +LK +DL NN Sbjct: 177 LKNLQELILDENLIGGAIPSEIGSLVELLTLTLRQNMFNSSIPSSVSRLTKLKTIDLQNN 236 Query: 472 IIES 483 + S Sbjct: 237 FLSS 240 >At3g50230.1 68416.m05493 leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase (RKL1), Arabidopsis thaliana, EMBL:AF084034 Length = 660 Score = 41.5 bits (93), Expect = 6e-04 Identities = 27/70 (38%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Frame = +1 Query: 265 TFEPETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLK 441 +F PET L L++LSL NNSI IP +L +++L+ L LS+N + L+ Sbjct: 89 SFSPETLSRLDQLRVLSLENNSISGSIP--DLSPLVNLKTLTLSKNGFSGTLSSSILSLR 146 Query: 442 ELKHLDLNNN 471 L LDL+ N Sbjct: 147 RLTELDLSFN 156 >At3g12610.1 68416.m01570 DNA-damage-repair/toleration protein, putative (DRT100) similar to DNA-damage-repair/toleration protein DRT100 [Precursor] SWISS-PROT:Q00874, NCBI_gi:5701788; contains multiple LRR repeats Pfam profile: PF00560 Length = 372 Score = 41.5 bits (93), Expect = 6e-04 Identities = 30/82 (36%), Positives = 38/82 (46%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P L+SL+IL L N I A +G + L L+L+EN + L L ELKH Sbjct: 128 PPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKH 187 Query: 454 LDLNNNIIESVDSIRFS*LPSL 519 L+L N I V F L L Sbjct: 188 LELTENGITGVIPADFGSLKML 209 >At5g01950.1 68418.m00114 leucine-rich repeat transmembrane protein kinase, putative receptor protein kinases Length = 1032 Score = 41.1 bits (92), Expect = 8e-04 Identities = 24/85 (28%), Positives = 39/85 (45%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P +SSL +L L N + + LG++ +L + EN I LK++KH Sbjct: 200 PNEIGQISSLVLLLLNGNKLSGTLPSELGYLSNLNRFQIDENNITGPIPKSFSNLKKVKH 259 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 L NNN + + S L ++ H+ Sbjct: 260 LHFNNNSLTGQIPVELSNLTNIFHV 284 Score = 35.5 bits (78), Expect = 0.040 Identities = 28/85 (32%), Positives = 44/85 (51%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P ++ S++ LSLRN S+ + + HL+YLDLS N + F K++ Sbjct: 321 PASYGNFSNILKLSLRNCSLKGA-LPDFSKIRHLKYLDLSWNELTGPIPSS-NFSKDVTT 378 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 ++L+NNI+ FS LP L+ L Sbjct: 379 INLSNNILNGSIPQSFSDLPLLQML 403 >At2g17440.1 68415.m02012 leucine-rich repeat family protein contains Pfam PF00560: Leucine Rich Repeats Length = 526 Score = 41.1 bits (92), Expect = 8e-04 Identities = 26/71 (36%), Positives = 38/71 (53%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L +L L+L N + +PS+ +IHLE LDLS N + + + L LK Sbjct: 269 PESIGDLLNLVNLNLSGNQLSSLPSS-FNRLIHLEELDLSSNSL-SILPESIGSLVSLKK 326 Query: 454 LDLNNNIIESV 486 LD+ N IE + Sbjct: 327 LDVETNNIEEI 337 >At1g06840.1 68414.m00729 leucine-rich repeat transmembrane protein kinase, putative similar to receptor protein kinase GB:BAA11869 GI:1389566 from [Arabidopsis thaliana] Length = 939 Score = 40.7 bits (91), Expect = 0.001 Identities = 29/85 (34%), Positives = 44/85 (51%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+++ +S L +SLRN S L P +L + +L YLDLS+N + G + Sbjct: 231 PQSYGNMSKLLKMSLRNCS-LQGPVPDLSSIPNLGYLDLSQNQLNGSIPAG-KLSDSITT 288 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 +DL+NN + FS LP L+ L Sbjct: 289 IDLSNNSLTGTIPTNFSGLPRLQKL 313 Score = 39.5 bits (88), Expect = 0.002 Identities = 24/85 (28%), Positives = 38/85 (44%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+ + SL++L L N + LGF+ +L+ + + EN I L + KH Sbjct: 110 PKEIGNIKSLELLLLNGNLLNGNLPEELGFLPNLDRIQIDENRISGPLPKSFANLNKTKH 169 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 +NNN I LPS+ H+ Sbjct: 170 FHMNNNSISGQIPPELGSLPSIVHI 194 Score = 29.5 bits (63), Expect = 2.7 Identities = 24/78 (30%), Positives = 33/78 (42%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 LS L ILS N I +G + LE L L+ NL+ L FL L + ++ N Sbjct: 92 LSRLTILSFMWNKITGSIPKEIGNIKSLELLLLNGNLLNGNLPEELGFLPNLDRIQIDEN 151 Query: 472 IIESVDSIRFS*LPSLRH 525 I F+ L +H Sbjct: 152 RISGPLPKSFANLNKTKH 169 >At4g20140.1 68417.m02947 leucine-rich repeat transmembrane protein kinase, putative Cf-2.2, Lycopersicon pimpinellifolium, PIR:T10515 Length = 1249 Score = 39.9 bits (89), Expect = 0.002 Identities = 27/67 (40%), Positives = 38/67 (56%), Gaps = 1/67 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 P L +L+IL+L NNS+ +IPS LG + L+YL L N +Q + L L L+ Sbjct: 232 PAELGRLENLEILNLANNSLTGEIPS-QLGEMSQLQYLSLMANQLQGLIPKSLADLGNLQ 290 Query: 451 HLDLNNN 471 LDL+ N Sbjct: 291 TLDLSAN 297 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/69 (33%), Positives = 34/69 (49%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + L L +L LR N ++ A+LG L LDL++N + FLK L+ Sbjct: 473 PPSIGRLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLSGSIPSSFGFLKGLEQ 532 Query: 454 LDLNNNIIE 480 L L NN ++ Sbjct: 533 LMLYNNSLQ 541 Score = 33.5 bits (73), Expect = 0.16 Identities = 20/60 (33%), Positives = 28/60 (46%) Frame = +1 Query: 298 SLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNII 477 +L L L N + LG + L LD+S N + L K+L H+DLNNN + Sbjct: 600 NLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNALTGTIPLQLVLCKKLTHIDLNNNFL 659 >At2g42800.1 68415.m05299 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; and grail Length = 462 Score = 39.9 bits (89), Expect = 0.002 Identities = 27/68 (39%), Positives = 41/68 (60%), Gaps = 2/68 (2%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKEL- 447 PE++ L++L LSL NN + +IPS + H+ +L+LS NL+ V FL+ L Sbjct: 326 PESYTKLTNLSSLSLANNRLTGEIPSG-FESLPHVFHLNLSRNLLIGVVPFDSSFLRRLG 384 Query: 448 KHLDLNNN 471 K+LDL+ N Sbjct: 385 KNLDLSGN 392 Score = 30.3 bits (65), Expect = 1.5 Identities = 23/85 (27%), Positives = 37/85 (43%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE E L SL ++L NN + + + L+Y + N + L FL +L+ Sbjct: 254 PEGVEKLRSLSFMALSNNKLKGAFPKGISNLQSLQYFIMDNNPMFVALPVELGFLPKLQE 313 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 L L N+ V ++ L +L L Sbjct: 314 LQLENSGYSGVIPESYTKLTNLSSL 338 >At5g06940.1 68418.m00784 leucine-rich repeat family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 872 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/66 (30%), Positives = 35/66 (53%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+ SSLK++ +N + + +LG + +L+ L+L NL+ + + L EL Sbjct: 140 PDQISEFSSLKVIDFSSNHVEGMIPEDLGLLFNLQVLNLGSNLLTGIVPPAIGKLSELVV 199 Query: 454 LDLNNN 471 LDL+ N Sbjct: 200 LDLSEN 205 Score = 30.3 bits (65), Expect = 1.5 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 1/70 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 P +F L+SL+ L L N++ +IP + + +L LD+S+N + G+ K L Sbjct: 237 PTSFVGLTSLRTLDLSLNNLSGEIPRSLGPSLKNLVSLDVSQNKLSGSFPSGICSGKRLI 296 Query: 451 HLDLNNNIIE 480 +L L++N E Sbjct: 297 NLSLHSNFFE 306 >At1g07390.1 68414.m00788 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596 Length = 976 Score = 39.5 bits (88), Expect = 0.002 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 1/78 (1%) Frame = +1 Query: 268 FEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLI-QQVSRHGLPFLKE 444 F P+ +++L++L+L++NS + S L LE LDLS N + + H L K Sbjct: 151 FPPQELSNMTNLRVLNLKDNSFSFLSSQGLTDFRDLEVLDLSFNGVNDSEASHSLSTAK- 209 Query: 445 LKHLDLNNNIIESVDSIR 498 LK LDLN N + ++ Sbjct: 210 LKTLDLNFNPLSDFSQLK 227 Score = 29.5 bits (63), Expect = 2.7 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 3/63 (4%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQ-QVSR--HGLPFLKELKHLDL 462 L L+ L L +N++ +P LG + HL LDLS N + +S GLP + E L L Sbjct: 331 LMKLRELDLSSNALTSLPYC-LGNLTHLRTLDLSNNQLNGNLSSFVSGLPSVLEYLSL-L 388 Query: 463 NNN 471 +NN Sbjct: 389 DNN 391 >At5g63710.1 68418.m07997 leucine-rich repeat transmembrane protein kinase, putative Length = 614 Score = 39.1 bits (87), Expect = 0.003 Identities = 29/83 (34%), Positives = 43/83 (51%), Gaps = 1/83 (1%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDL-NN 468 L L L L+NNS+ +LG +++L+ L+LS N L LKHLDL +N Sbjct: 115 LKFLVTLELQNNSLSGALPDSLGNMVNLQTLNLSVNSFSGSIPASWSQLSNLKHLDLSSN 174 Query: 469 NIIESVDSIRFS*LPSLRHLGPQ 537 N+ S+ + FS +P+ G Q Sbjct: 175 NLTGSIPTQFFS-IPTFDFSGTQ 196 >At1g28440.1 68414.m03496 leucine-rich repeat transmembrane protein kinase, putative similar to receptor kinase GI:4105699 from [Arabidopsis thaliana] Length = 996 Score = 39.1 bits (87), Expect = 0.003 Identities = 26/66 (39%), Positives = 32/66 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P LS+L LSL NNSI N+ L+ LDLS+NL+ L + L H Sbjct: 77 PSVICRLSNLAHLSLYNNSINSTLPLNIAACKSLQTLDLSQNLLTGELPQTLADIPTLVH 136 Query: 454 LDLNNN 471 LDL N Sbjct: 137 LDLTGN 142 >At5g62230.1 68418.m07814 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 966 Score = 38.7 bits (86), Expect = 0.004 Identities = 24/79 (30%), Positives = 40/79 (50%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L +L+ + L+ N + +G L YLDLSENL+ + LK+L+ L+L NN Sbjct: 94 LRNLQSIDLQGNKLAGQIPDEIGNCASLVYLDLSENLLYGDIPFSISKLKQLETLNLKNN 153 Query: 472 IIESVDSIRFS*LPSLRHL 528 + + +P+L+ L Sbjct: 154 QLTGPVPATLTQIPNLKRL 172 Score = 33.5 bits (73), Expect = 0.16 Identities = 23/66 (34%), Positives = 32/66 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P T L L IL+L N + A G + ++ +D+S NL+ V L L+ L Sbjct: 447 PLTLGDLEHLLILNLSRNHLSGQLPAEFGNLRSIQMIDVSFNLLSGVIPTELGQLQNLNS 506 Query: 454 LDLNNN 471 L LNNN Sbjct: 507 LILNNN 512 Score = 30.7 bits (66), Expect = 1.2 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 1/69 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN-LIQQVSRHGLPFLKELK 450 P + L L+ L+L+NN + A L + +L+ LDL+ N L ++SR L + + L+ Sbjct: 136 PFSISKLKQLETLNLKNNQLTGPVPATLTQIPNLKRLDLAGNHLTGEISRL-LYWNEVLQ 194 Query: 451 HLDLNNNII 477 +L L N++ Sbjct: 195 YLGLRGNML 203 >At5g05160.1 68418.m00549 leucine-rich repeat transmembrane protein kinase, putative Length = 640 Score = 38.7 bits (86), Expect = 0.004 Identities = 25/68 (36%), Positives = 40/68 (58%), Gaps = 2/68 (2%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQ-QVSRHGLPFL-KEL 447 P T L +LK+LSLR+NS+ +++ + LEYL L N +++ + LP + K+L Sbjct: 91 PATLGKLDALKVLSLRSNSLFGTLPSDILSLPSLEYLYLQHNNFSGELTTNSLPSISKQL 150 Query: 448 KHLDLNNN 471 LDL+ N Sbjct: 151 VVLDLSYN 158 >At3g28040.1 68416.m03500 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profiles: PF00560 leucine rich repeat, PF00069 eukaryotic protein kinase domain Length = 1016 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/62 (33%), Positives = 31/62 (50%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L +LK L L+ N +++G HL +DLS N L LK L H D++NN Sbjct: 246 LHNLKELQLQRNQFSGALPSDIGLCPHLNRVDLSSNHFSGELPRTLQKLKSLNHFDVSNN 305 Query: 472 II 477 ++ Sbjct: 306 LL 307 Score = 38.3 bits (85), Expect = 0.006 Identities = 29/82 (35%), Positives = 41/82 (50%), Gaps = 1/82 (1%) Frame = +1 Query: 286 EPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLN 465 + L LK+LSL NN+ +A L HL+ LDLS N + L + L+HLDL Sbjct: 98 QKLQRLKVLSLSNNNFTGNINA-LSNNNHLQKLDLSHNNLSGQIPSSLGSITSLQHLDLT 156 Query: 466 NNIIE-SVDSIRFS*LPSLRHL 528 N ++ F+ SLR+L Sbjct: 157 GNSFSGTLSDDLFNNCSSLRYL 178 Score = 34.7 bits (76), Expect = 0.071 Identities = 21/60 (35%), Positives = 30/60 (50%) Frame = +1 Query: 298 SLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNII 477 SL L L +NS+ +G IH+ YL+LS N + FL+ L LDL N+ + Sbjct: 416 SLIRLDLSHNSLTGSIPGEVGLFIHMRYLNLSWNHFNTRVPPEIEFLQNLTVLDLRNSAL 475 Score = 28.7 bits (61), Expect = 4.6 Identities = 21/58 (36%), Positives = 27/58 (46%) Frame = +1 Query: 298 SLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 SL+IL L NS+ +G L+ L LS N + L L+ELK L L N Sbjct: 488 SLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLTGPIPKSLSNLQELKILKLEAN 545 >At5g45770.1 68418.m05627 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 425 Score = 38.3 bits (85), Expect = 0.006 Identities = 24/79 (30%), Positives = 40/79 (50%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L +LK L+L +NS+ + + L+ L L+ N + + L + EL HLDL+ N Sbjct: 216 LKNLKSLNLSHNSLSGQIPNKIKSLTFLKNLSLASNKLSGTIPNSLSSISELTHLDLSMN 275 Query: 472 IIESVDSIRFS*LPSLRHL 528 + FS + +L+HL Sbjct: 276 QLNGTVPSFFSEMKNLKHL 294 Score = 37.1 bits (82), Expect = 0.013 Identities = 23/71 (32%), Positives = 34/71 (47%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + L+ LK LSL +N + +L + L +LDLS N + +K LKH Sbjct: 234 PNKIKSLTFLKNLSLASNKLSGTIPNSLSSISELTHLDLSMNQLNGTVPSFFSEMKNLKH 293 Query: 454 LDLNNNIIESV 486 L+L +N V Sbjct: 294 LNLADNSFHGV 304 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 8 TQLTVLDISYNKILDLGSENFESNSEMRHLNLSNN 112 ++LT LD+S N++ F ++HLNL++N Sbjct: 265 SELTHLDLSMNQLNGTVPSFFSEMKNLKHLNLADN 299 >At2g35620.1 68415.m04368 leucine-rich repeat transmembrane protein kinase, putative similar to somatic embryogenesis receptor-like kinase 1 (SERK1) [Zea mays] gi|13897318|emb|CAC37640; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 589 Score = 37.9 bits (84), Expect = 0.008 Identities = 26/76 (34%), Positives = 36/76 (47%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L H+L P L L++L L NN++ A+LG LE + L N I Sbjct: 80 LTYHKLRGPLPPELGKLDQLRLLMLHNNALYQSIPASLGNCTALEGIYLQNNYITGTIPS 139 Query: 424 GLPFLKELKHLDLNNN 471 + L LK+LDL+NN Sbjct: 140 EIGNLSGLKNLDLSNN 155 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/68 (27%), Positives = 34/68 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + ++L+ + L+NN I + +G + L+ LDLS N + L LK L Sbjct: 114 PASLGNCTALEGIYLQNNYITGTIPSEIGNLSGLKNLDLSNNNLNGAIPASLGQLKRLTK 173 Query: 454 LDLNNNII 477 +++NN + Sbjct: 174 FNVSNNFL 181 >At4g35470.1 68417.m05041 leucine-rich repeat family protein similar to Leucine-rich repeat protein SHOC-2 (Ras-binding protein Sur-8) (SP:Q9UQ13 ){Homo sapiens},PIR:T12704; contains Pfam PF00560: Leucine Rich Repeat domains Length = 549 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/71 (32%), Positives = 40/71 (56%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE +++L+ILS+R N+I +P+ + + L+ LD+S N ++ V L F L Sbjct: 377 PEAIGKITTLEILSVRYNNIRQLPT-TMSSLASLKELDVSFNELESVP-ESLCFATTLVK 434 Query: 454 LDLNNNIIESV 486 L++ NN + V Sbjct: 435 LNIGNNFADMV 445 Score = 37.1 bits (82), Expect = 0.013 Identities = 25/71 (35%), Positives = 38/71 (53%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L +L L+L +N + +PSA ++ LE LDLS N + + + L LK Sbjct: 285 PESIGELLNLVYLNLGSNQLSSLPSA-FSRLVRLEELDLSCNNL-PILPESIGSLVSLKK 342 Query: 454 LDLNNNIIESV 486 LD+ N IE + Sbjct: 343 LDVETNDIEEI 353 Score = 34.3 bits (75), Expect = 0.094 Identities = 23/66 (34%), Positives = 35/66 (53%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P T LSSL L L +N I +P ++G +++L YL+L N + + L L+ Sbjct: 262 PNTIGGLSSLTKLDLHSNRIGQLPE-SIGELLNLVYLNLGSNQLSSLP-SAFSRLVRLEE 319 Query: 454 LDLNNN 471 LDL+ N Sbjct: 320 LDLSCN 325 >At4g28490.1 68417.m04076 leucine-rich repeat transmembrane protein kinase, putative Length = 999 Score = 37.5 bits (83), Expect = 0.010 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 3/70 (4%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIH-LEYLDLSENLIQQVSRHGLPF-LKELKHLDLN 465 L SL LSL NNSI SA+ H L LDLSENL+ LPF L LK L+++ Sbjct: 88 LPSLHSLSLYNNSINGSLSADDFDTCHNLISLDLSENLLVGSIPKSLPFNLPNLKFLEIS 147 Query: 466 -NNIIESVDS 492 NN+ +++ S Sbjct: 148 GNNLSDTIPS 157 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 PE+ +L L L NN + + + LG L+Y+DLS N Sbjct: 324 PESITRSKTLSELKLFNNRLTGVLPSQLGANSPLQYVDLSYN 365 >At3g57830.1 68416.m06447 leucine-rich repeat transmembrane protein kinase, putative several receptor-like protein kinases Length = 662 Score = 37.5 bits (83), Expect = 0.010 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 1/75 (1%) Frame = +1 Query: 256 RLVTFEPETFEPLSSLKILSL-RNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLP 432 RL + P L SL L L RNN +P+ L ++L Y+DLS N I + Sbjct: 79 RLSGYIPSKLGLLDSLIKLDLARNNFSKPVPT-RLFNAVNLRYIDLSHNSISGPIPAQIQ 137 Query: 433 FLKELKHLDLNNNII 477 LK L H+D ++N++ Sbjct: 138 SLKNLTHIDFSSNLL 152 >At3g15410.1 68416.m01955 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596; identical to leucine-rich repeat protein [Arabidopsis thaliana] gi|2760084|emb|CAA76000 Length = 584 Score = 37.5 bits (83), Expect = 0.010 Identities = 24/72 (33%), Positives = 40/72 (55%) Frame = +1 Query: 271 EPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 E F L L+ L L + ++P L + +L LDL++N +Q + + G+ + LK Sbjct: 468 EHPKFCHLPQLRELYLSRIQLSEVPEDILN-LSNLIILDLNQNSLQSIPK-GIKNMTSLK 525 Query: 451 HLDLNNNIIESV 486 HLD++NN I S+ Sbjct: 526 HLDISNNNISSL 537 >At2g27060.1 68415.m03251 leucine-rich repeat transmembrane protein kinase, putative Length = 1007 Score = 37.5 bits (83), Expect = 0.010 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 1/83 (1%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLN-N 468 L L+ LS+ NN S N+G + L+YLD+S NL G+ L+ L+ ++L+ N Sbjct: 79 LRMLQNLSIANNQFSGTLS-NIGSLTSLKYLDVSGNLFHGALPSGIENLRNLEFVNLSGN 137 Query: 469 NIIESVDSIRFS*LPSLRHLGPQ 537 N + V F L L++L Q Sbjct: 138 NNLGGVIPSGFGSLAKLKYLDLQ 160 Score = 33.9 bits (74), Expect = 0.12 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 3/69 (4%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGL---PFLKE 444 P F L+ LK L L+ NS + +I +EY+D+S N GL F+ Sbjct: 145 PSGFGSLAKLKYLDLQGNSFSGEVMSLFSQLISVEYVDISRNNFSGSLDLGLAKSSFVSS 204 Query: 445 LKHLDLNNN 471 ++HL+++ N Sbjct: 205 IRHLNVSGN 213 Score = 30.7 bits (66), Expect = 1.2 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 4/89 (4%) Frame = +1 Query: 274 PETFEPLSSLKILSLR-NNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 P E L +L+ ++L NN++ + + G + L+YLDL N L ++ Sbjct: 120 PSGIENLRNLEFVNLSGNNNLGGVIPSGFGSLAKLKYLDLQGNSFSGEVMSLFSQLISVE 179 Query: 451 HLDLN-NNIIESVD--SIRFS*LPSLRHL 528 ++D++ NN S+D + S + S+RHL Sbjct: 180 YVDISRNNFSGSLDLGLAKSSFVSSIRHL 208 Score = 29.1 bits (62), Expect = 3.5 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +1 Query: 301 LKILSLR--NNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L++ SL+ NNS+ + LG L+ +DLS N + V L +L L+L+NN Sbjct: 369 LRLTSLKAANNSLQGVLPFILGTYPELKEIDLSHNQLSGVIPSNLFISAKLTELNLSNN 427 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +2 Query: 5 YTQLTVLDISYNKILDLGSENFESNSEMRHLNLSNN 112 Y +L +D+S+N++ + N ++++ LNLSNN Sbjct: 392 YPELKEIDLSHNQLSGVIPSNLFISAKLTELNLSNN 427 Score = 28.3 bits (60), Expect = 6.1 Identities = 18/63 (28%), Positives = 30/63 (47%) Frame = +1 Query: 298 SLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNII 477 S++I+ L +NS+ + L L + N +Q V L ELK +DL++N + Sbjct: 346 SVEIIRLSSNSLTGTLPGQTSQFLRLTSLKAANNSLQGVLPFILGTYPELKEIDLSHNQL 405 Query: 478 ESV 486 V Sbjct: 406 SGV 408 >At1g34110.1 68414.m04230 leucine-rich repeat transmembrane protein kinase, putative contains similarity to receptor protein kinase-like protein GI:10177178 from [Arabidopsis thaliana] Length = 1045 Score = 37.5 bits (83), Expect = 0.010 Identities = 26/69 (37%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 P ++ L++L + NN I DIP A LG +++LE LDLS N L L Sbjct: 474 PYEISNITVLELLDVHNNYITGDIP-AQLGNLVNLEQLDLSRNSFTGNIPLSFGNLSYLN 532 Query: 451 HLDLNNNII 477 L LNNN++ Sbjct: 533 KLILNNNLL 541 Score = 31.1 bits (67), Expect = 0.87 Identities = 21/60 (35%), Positives = 30/60 (50%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 LSSL+ L+L + ++ + G + HL LDLS N + L L L+ L LN N Sbjct: 71 LSSLQFLNLSSTNLSGPIPPSFGKLTHLRLLDLSSNSLSGPIPSELGRLSTLQFLILNAN 130 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 8 TQLTV-LDISYNKILDLGSENFESNSEMRHLNLSNNFL 118 T LT+ LD+SYN E F ++++ L+LS+N L Sbjct: 577 TSLTINLDLSYNTFTGNIPETFSDLTQLQSLDLSSNSL 614 Score = 27.9 bits (59), Expect = 8.1 Identities = 27/80 (33%), Positives = 37/80 (46%), Gaps = 3/80 (3%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 PETF L+ L+ L L +NS+ DI LG + L L++S N PF K + Sbjct: 595 PETFSDLTQLQSLDLSSNSLHGDIKV--LGSLTSLASLNISCNNFSG-PIPSTPFFKTIS 651 Query: 451 HLDL--NNNIIESVDSIRFS 504 N N+ S+D I S Sbjct: 652 TTSYLQNTNLCHSLDGITCS 671 >At1g33600.1 68414.m04159 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to gi|9294355|dbj|BAB02252 [Arabidopsis thaliana] Length = 478 Score = 37.5 bits (83), Expect = 0.010 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 1/93 (1%) Frame = +1 Query: 253 HRLVTFEPETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGL 429 +RL P+ F+ + L+ L+L N ++P + L YLDLS+N + L Sbjct: 208 NRLSETIPDIFKSMQKLQSLTLSRNKFSGNLPPSIASLKPILNYLDLSQNNLSGTIPTFL 267 Query: 430 PFLKELKHLDLNNNIIESVDSIRFS*LPSLRHL 528 K L LDL+ N V + +P L HL Sbjct: 268 SNFKVLDSLDLSRNRFSGVVPKSLANMPKLFHL 300 Score = 28.7 bits (61), Expect = 4.6 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P LS L LSL N +++ + L L+L +NL+ GL LK L Sbjct: 143 PANIGALSELGELSLDGNLFTGPIPSSISNLTRLYLLNLGDNLLTGTIPLGLANLKILLS 202 Query: 454 LDL-NNNIIESVDSI 495 L+ NN + E++ I Sbjct: 203 LNFGNNRLSETIPDI 217 Score = 27.9 bits (59), Expect = 8.1 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +1 Query: 301 LKILSLRNNSILD-IPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNII 477 L L L N++ IP+ F + L+ LDLS N V L + +L HL+L++N + Sbjct: 249 LNYLDLSQNNLSGTIPTFLSNFKV-LDSLDLSRNRFSGVVPKSLANMPKLFHLNLSHNFL 307 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 14 LTVLDISYNKILDLGSENFESNSEMRHLNLSNNFL 118 L LD+S N+ + ++ + ++ HLNLS+NFL Sbjct: 273 LDSLDLSRNRFSGVVPKSLANMPKLFHLNLSHNFL 307 >At5g44700.1 68418.m05477 leucine-rich repeat transmembrane protein kinase, putative Length = 1252 Score = 37.1 bits (82), Expect = 0.013 Identities = 25/72 (34%), Positives = 41/72 (56%), Gaps = 1/72 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 P L +L+ L+L +NS +IPS LG ++ ++YL+L N +Q + L L L+ Sbjct: 233 PAELNRLKNLQTLNLGDNSFSGEIPS-QLGDLVSIQYLNLIGNQLQGLIPKRLTELANLQ 291 Query: 451 HLDLNNNIIESV 486 LDL++N + V Sbjct: 292 TLDLSSNNLTGV 303 Score = 36.7 bits (81), Expect = 0.018 Identities = 22/66 (33%), Positives = 32/66 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P TF +S L +L + NS+ I LG L ++DL+ N + V L L L Sbjct: 617 PRTFGKISELSLLDISRNSLSGIIPVELGLCKKLTHIDLNNNYLSGVIPTWLGKLPLLGE 676 Query: 454 LDLNNN 471 L L++N Sbjct: 677 LKLSSN 682 Score = 36.3 bits (80), Expect = 0.023 Identities = 24/78 (30%), Positives = 33/78 (42%) Frame = +1 Query: 295 SSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNI 474 ++L L L N G + L LD+S N + + L K+L H+DLNNN Sbjct: 600 TNLDRLRLGKNQFTGRIPRTFGKISELSLLDISRNSLSGIIPVELGLCKKLTHIDLNNNY 659 Query: 475 IESVDSIRFS*LPSLRHL 528 + V LP L L Sbjct: 660 LSGVIPTWLGKLPLLGEL 677 Score = 33.5 bits (73), Expect = 0.16 Identities = 32/94 (34%), Positives = 43/94 (45%), Gaps = 1/94 (1%) Frame = +1 Query: 244 LLKHRLVTFEPETF-EPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSR 420 L K+RL P+T +SLK L L + A + L+ LDLS N + Sbjct: 319 LAKNRLSGSLPKTICSNNTSLKQLFLSETQLSGEIPAEISNCQSLKLLDLSNNTLTGQIP 378 Query: 421 HGLPFLKELKHLDLNNNIIESVDSIRFS*LPSLR 522 L L EL +L LNNN +E S S L +L+ Sbjct: 379 DSLFQLVELTNLYLNNNSLEGTLSSSISNLTNLQ 412 >At3g11330.1 68416.m01378 leucine-rich repeat family protein Length = 499 Score = 37.1 bits (82), Expect = 0.013 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 1/84 (1%) Frame = +1 Query: 247 LKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHG 426 L R + PE F + L +L+L NN + IP + G +E LD+S N ++ + Sbjct: 205 LSGRKLRLLPEAFGRIQGLLVLNLSNNKLESIPDSIAGLHSLVE-LDVSTNSLETLP-DS 262 Query: 427 LPFLKELKHLDLNNNIIESV-DSI 495 + L +LK L+++ N + S+ DSI Sbjct: 263 IGLLSKLKILNVSTNKLTSLPDSI 286 >At1g08590.1 68414.m00952 CLAVATA1 receptor kinase (CLV1) similar to receptor-like protein kinase (Ipomoea nil) (U77888) Length = 1029 Score = 37.1 bits (82), Expect = 0.013 Identities = 23/76 (30%), Positives = 39/76 (51%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L++++L P L +L++L L NS++ +LG L++LD+S N + Sbjct: 324 LMRNQLTGIIPSKIAELPNLEVLELWQNSLMGSLPVHLGKNSPLKWLDVSSNKLSGDIPS 383 Query: 424 GLPFLKELKHLDLNNN 471 GL + + L L L NN Sbjct: 384 GLCYSRNLTKLILFNN 399 Score = 30.7 bits (66), Expect = 1.2 Identities = 24/85 (28%), Positives = 38/85 (44%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + L L + L N + LG + L +LDLS+N I + LK L+ Sbjct: 262 PSSLGQLKQLTTVYLYQNRLTGKLPRELGGMTSLVFLDLSDNQITGEIPMEVGELKNLQL 321 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 L+L N + + + + LP+L L Sbjct: 322 LNLMRNQLTGIIPSKIAELPNLEVL 346 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 2 LYTQLTVLDISYNKILDLGSENFESNSEMRHLNLSNNFLKRL 127 L T L+ +DIS+N + L S F S + + NNF ++ Sbjct: 459 LSTSLSFIDISFNHLSSLSSSIFSSPNLQTFIASHNNFAGKI 500 >At5g48940.1 68418.m06054 leucine-rich repeat transmembrane protein kinase, putative Length = 1135 Score = 36.7 bits (81), Expect = 0.018 Identities = 25/78 (32%), Positives = 41/78 (52%) Frame = +1 Query: 295 SSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNI 474 +SL L L NN I +GF+ +L +LDLSEN + + ++L+ L+L+NN Sbjct: 467 TSLVRLRLVNNRITGEIPKGIGFLQNLSFLDLSENNLSGPVPLEISNCRQLQMLNLSNNT 526 Query: 475 IESVDSIRFS*LPSLRHL 528 ++ + S L L+ L Sbjct: 527 LQGYLPLSLSSLTKLQVL 544 Score = 31.1 bits (67), Expect = 0.87 Identities = 20/66 (30%), Positives = 31/66 (46%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P +SL+ L + N ++ S+ +G L +DLS N + L LK L+ Sbjct: 99 PPNISSFTSLQKLVISNTNLTGAISSEIGDCSELIVIDLSSNSLVGEIPSSLGKLKNLQE 158 Query: 454 LDLNNN 471 L LN+N Sbjct: 159 LCLNSN 164 Score = 29.1 bits (62), Expect = 3.5 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 2/76 (2%) Frame = +1 Query: 274 PETFEPLSSL-KILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 P+ L +L K+L +NN IP +GF+ L +DLS N L L+ Sbjct: 292 PKELGKLQNLEKMLLWQNNLHGPIPE-EIGFMKSLNAIDLSMNYFSGTIPKSFGNLSNLQ 350 Query: 451 HLDL-NNNIIESVDSI 495 L L +NNI S+ SI Sbjct: 351 ELMLSSNNITGSIPSI 366 >At5g19680.1 68418.m02341 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 328 Score = 36.7 bits (81), Expect = 0.018 Identities = 29/90 (32%), Positives = 49/90 (54%) Frame = +1 Query: 226 CFRKT*LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLI 405 C +K L +RL + + FE +L+ L L +N I + L +++L LD+S N + Sbjct: 198 CIKKISLQSNRLTSMKG--FEECVALEELYLSHNGISKMEG--LSALVNLRVLDVSNNKL 253 Query: 406 QQVSRHGLPFLKELKHLDLNNNIIESVDSI 495 V + L +L+ L LN+N IES+++I Sbjct: 254 TSVD--DIQNLTKLEDLWLNDNQIESLEAI 281 Score = 32.7 bits (71), Expect = 0.29 Identities = 24/69 (34%), Positives = 38/69 (55%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L +K +SL++N + + + LE L LS N I ++ GL L L+ LD++NN Sbjct: 196 LKCIKKISLQSNRLTSMKGFEE--CVALEELYLSHNGISKME--GLSALVNLRVLDVSNN 251 Query: 472 IIESVDSIR 498 + SVD I+ Sbjct: 252 KLTSVDDIQ 260 >At4g39270.2 68417.m05561 leucine-rich repeat transmembrane protein kinase, putative receptor protein kinase erecta, Arabidopsis thaliana Length = 694 Score = 36.7 bits (81), Expect = 0.018 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 PE+ LS LK+L L N+I DIP +L + +L LDLS N + + L +L+ Sbjct: 143 PESLTRLSHLKVLDLSKNAINGDIP-LSLTSLQNLSILDLSSNSVFGSIPANIGALSKLQ 201 Query: 451 HLDLNNNIIES 483 L+L+ N + S Sbjct: 202 RLNLSRNTLTS 212 Score = 35.5 bits (78), Expect = 0.040 Identities = 23/66 (34%), Positives = 33/66 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + L +L IL L +NS+ AN+G + L+ L+LS N + L L L Sbjct: 167 PLSLTSLQNLSILDLSSNSVFGSIPANIGALSKLQRLNLSRNTLTSSIPPSLGDLSVLID 226 Query: 454 LDLNNN 471 LDL+ N Sbjct: 227 LDLSFN 232 Score = 33.5 bits (73), Expect = 0.16 Identities = 22/62 (35%), Positives = 34/62 (54%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L +L++L L + SI +L + HL+ LDLS+N I L L+ L LDL++N Sbjct: 125 LLTLEVLDLSSCSITGTIPESLTRLSHLKVLDLSKNAINGDIPLSLTSLQNLSILDLSSN 184 Query: 472 II 477 + Sbjct: 185 SV 186 >At4g39270.1 68417.m05562 leucine-rich repeat transmembrane protein kinase, putative receptor protein kinase erecta, Arabidopsis thaliana Length = 864 Score = 36.7 bits (81), Expect = 0.018 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 PE+ LS LK+L L N+I DIP +L + +L LDLS N + + L +L+ Sbjct: 143 PESLTRLSHLKVLDLSKNAINGDIP-LSLTSLQNLSILDLSSNSVFGSIPANIGALSKLQ 201 Query: 451 HLDLNNNIIES 483 L+L+ N + S Sbjct: 202 RLNLSRNTLTS 212 Score = 35.5 bits (78), Expect = 0.040 Identities = 23/66 (34%), Positives = 33/66 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + L +L IL L +NS+ AN+G + L+ L+LS N + L L L Sbjct: 167 PLSLTSLQNLSILDLSSNSVFGSIPANIGALSKLQRLNLSRNTLTSSIPPSLGDLSVLID 226 Query: 454 LDLNNN 471 LDL+ N Sbjct: 227 LDLSFN 232 Score = 33.5 bits (73), Expect = 0.16 Identities = 22/62 (35%), Positives = 34/62 (54%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L +L++L L + SI +L + HL+ LDLS+N I L L+ L LDL++N Sbjct: 125 LLTLEVLDLSSCSITGTIPESLTRLSHLKVLDLSKNAINGDIPLSLTSLQNLSILDLSSN 184 Query: 472 II 477 + Sbjct: 185 SV 186 >At4g36180.1 68417.m05148 leucine-rich repeat family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 1136 Score = 36.7 bits (81), Expect = 0.018 Identities = 26/85 (30%), Positives = 38/85 (44%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P L+ L++L+L N + A+LG + L+YL L NL+Q + L H Sbjct: 179 PSGLANLTQLQLLNLSYNQLTGEIPASLGNLQSLQYLWLDFNLLQGTLPSAISNCSSLVH 238 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 L + N I V + LP L L Sbjct: 239 LSASENEIGGVIPAAYGALPKLEVL 263 Score = 34.3 bits (75), Expect = 0.094 Identities = 26/85 (30%), Positives = 38/85 (44%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE + +LK+LSL NS +++ + LE L+L EN + L L L Sbjct: 397 PEFLGYMKALKVLSLGRNSFSGYVPSSMVNLQQLERLNLGENNLNGSFPVELMALTSLSE 456 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 LDL+ N + S L +L L Sbjct: 457 LDLSGNRFSGAVPVSISNLSNLSFL 481 Score = 30.7 bits (66), Expect = 1.2 Identities = 24/66 (36%), Positives = 29/66 (43%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+TF L L LSL +N I +G LE L+L N + L L LK Sbjct: 565 PQTFGFLRLLVSLSLSDNHISGSIPPEIGNCSALEVLELRSNRLMGHIPADLSRLPRLKV 624 Query: 454 LDLNNN 471 LDL N Sbjct: 625 LDLGQN 630 Score = 30.3 bits (65), Expect = 1.5 Identities = 26/85 (30%), Positives = 38/85 (44%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE F L SL+ ++L +NS GF+ L L LS+N I + L+ Sbjct: 541 PEGFSSLVSLRYVNLSSNSFSGEIPQTFGFLRLLVSLSLSDNHISGSIPPEIGNCSALEV 600 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 L+L +N + S LP L+ L Sbjct: 601 LELRSNRLMGHIPADLSRLPRLKVL 625 Score = 28.7 bits (61), Expect = 4.6 Identities = 21/85 (24%), Positives = 34/85 (40%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + SL +L NS+ LG++ L+ L L N + L++L+ Sbjct: 373 PVEIKQCGSLDVLDFEGNSLKGQIPEFLGYMKALKVLSLGRNSFSGYVPSSMVNLQQLER 432 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 L+L N + + L SL L Sbjct: 433 LNLGENNLNGSFPVELMALTSLSEL 457 >At4g26050.1 68417.m03750 leucine-rich repeat family protein contains Pfam PF00560: Leucine Rich Repeat domains; Length = 383 Score = 36.7 bits (81), Expect = 0.018 Identities = 20/65 (30%), Positives = 40/65 (61%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L+S+ L L NN+I IP + + +++L LDL N ++ + + + L +LK L+++ N Sbjct: 79 LASISKLDLSNNNIQKIPESLVARMLNLWALDLQSNQLKTLP-NSIGCLSKLKFLNVSGN 137 Query: 472 IIESV 486 ++S+ Sbjct: 138 YLQSL 142 >At5g10020.1 68418.m01161 leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase ERECTA, Arabidopsis thaliana, EMBL:AC004484 Length = 1048 Score = 36.3 bits (80), Expect = 0.023 Identities = 28/83 (33%), Positives = 39/83 (46%) Frame = +1 Query: 280 TFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLD 459 T L+ L+ LSL NS +LG + L++LDLS+N + L L HL+ Sbjct: 94 TLSGLTRLRNLSLSGNSFSGRVVPSLGGISSLQHLDLSDNGFYGPIPGRISELWSLNHLN 153 Query: 460 LNNNIIESVDSIRFS*LPSLRHL 528 L++N E F L LR L Sbjct: 154 LSSNKFEGGFPSGFRNLQQLRSL 176 Score = 28.3 bits (60), Expect = 6.1 Identities = 16/57 (28%), Positives = 30/57 (52%) Frame = +1 Query: 301 LKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 +++L L NS+ + ++G + ++ L+L+ N + L L L LDL+NN Sbjct: 470 MELLDLSTNSLTGMLPGDIGTMEKIKVLNLANNKLSGELPSDLNKLSGLLFLDLSNN 526 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 8 TQLTVLDISYNKILDLGSENFESNSEMRHLNLSNNFLK 121 +Q +V+D+S NK +F + + +R LNLS N L+ Sbjct: 411 SQFSVIDLSSNKFSGFIPVSFFTFASLRSLNLSRNNLE 448 >At2g26330.1 68415.m03159 leucine-rich repeat protein kinase, putative (ERECTA) identical to uncharacterized receptor protein kinase ERECTA [Arabidopsis thaliana] gi|1389566|dbj|BAA11869; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 976 Score = 36.3 bits (80), Expect = 0.023 Identities = 23/68 (33%), Positives = 34/68 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + +L L L NN I I ++LG + HL ++LS N I V L+ + Sbjct: 420 PVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIME 479 Query: 454 LDLNNNII 477 +DL+NN I Sbjct: 480 IDLSNNDI 487 Score = 29.9 bits (64), Expect = 2.0 Identities = 24/79 (30%), Positives = 36/79 (45%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L SL + LR N + +G L+ LDLS N + + LK+L+ L L NN Sbjct: 91 LKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNN 150 Query: 472 IIESVDSIRFS*LPSLRHL 528 + S +P+L+ L Sbjct: 151 QLIGPIPSTLSQIPNLKIL 169 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/72 (25%), Positives = 39/72 (54%), Gaps = 1/72 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + L L+ L L+NN ++ + L + +L+ LDL++N + + + + L++ Sbjct: 133 PFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQY 192 Query: 454 LDL-NNNIIESV 486 L L NN++ ++ Sbjct: 193 LGLRGNNLVGNI 204 >At2g02220.1 68415.m00159 leucine-rich repeat transmembrane protein kinase, putative Length = 1008 Score = 36.3 bits (80), Expect = 0.023 Identities = 23/66 (34%), Positives = 32/66 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P++ SL +L+LRNNS+ N +I L LDL N LP K LK+ Sbjct: 285 PKSLANSPSLNLLNLRNNSLSGRLMLNCTAMIALNSLDLGTNRFNGRLPENLPDCKRLKN 344 Query: 454 LDLNNN 471 ++L N Sbjct: 345 VNLARN 350 >At1g75820.1 68414.m08807 CLAVATA1 receptor kinase (CLV1) identical to receptor kinase (CLV1) GB:AAB58929 GI:2160756 [Arabidopsis thaliana] Length = 980 Score = 36.3 bits (80), Expect = 0.023 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 2/88 (2%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL--DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKEL 447 P + L+SLK+L++ NN L P L ++ LE LD N + LK+L Sbjct: 111 PLEMKSLTSLKVLNISNNGNLTGTFPGEILKAMVDLEVLDTYNNNFNGKLPPEMSELKKL 170 Query: 448 KHLDLNNNIIESVDSIRFS*LPSLRHLG 531 K+L N + + SL +LG Sbjct: 171 KYLSFGGNFFSGEIPESYGDIQSLEYLG 198 Score = 29.9 bits (64), Expect = 2.0 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 1/77 (1%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSL-RNNSILDIPSANLGFVIHLEYLDLSENLIQQVSR 420 L ++ L PE L L++ + NN L +P ANLG +L LD+S+N + + Sbjct: 320 LFRNNLYGQIPEAIGELPKLEVFEVWENNFTLQLP-ANLGRNGNLIKLDVSDNHLTGLIP 378 Query: 421 HGLPFLKELKHLDLNNN 471 L ++L+ L L+NN Sbjct: 379 KDLCRGEKLEMLILSNN 395 >At1g71400.1 68414.m08246 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596 Length = 847 Score = 36.3 bits (80), Expect = 0.023 Identities = 29/93 (31%), Positives = 49/93 (52%), Gaps = 1/93 (1%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSR 420 L +RLV P++ L L+ LSL +N+++ +IPS +LG + +L +L L+ N + Sbjct: 189 LFSNRLVGKIPDSIGDLKQLRNLSLASNNLIGEIPS-SLGNLSNLVHLVLTHNQLVGEVP 247 Query: 421 HGLPFLKELKHLDLNNNIIESVDSIRFS*LPSL 519 + L EL+ + NN + I F+ L L Sbjct: 248 ASIGNLIELRVMSFENNSLSGNIPISFANLTKL 280 Score = 34.3 bits (75), Expect = 0.094 Identities = 18/69 (26%), Positives = 35/69 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L L++L+L N+ + L + LE LD+S N + L L L + Sbjct: 675 PESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSY 734 Query: 454 LDLNNNIIE 480 ++ ++N+++ Sbjct: 735 MNFSHNLLQ 743 >At1g64210.1 68414.m07274 leucine-rich repeat transmembrane protein kinase, putative contains 1 predicted transmembrane domain; similar to receptor-like protein kinase (GI:4008006) [Arabidopsis thaliana]; similar to receptor-like kinase RHG1 (GI:21239382) [Glycine max]; similar to receptor-like protein kinase 3 (GI:13506810) [Lycopersicon esculentum] Length = 587 Score = 36.3 bits (80), Expect = 0.023 Identities = 37/90 (41%), Positives = 43/90 (47%), Gaps = 5/90 (5%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPS--ANLGFVIH--LEYLDLSENLIQQVSRHGLPFL 438 P T LSSLK LSLR N D PS NL + H L++ LS L+ S L Sbjct: 81 PFTISRLSSLKFLSLRKNHFTGDFPSDFTNLKSLTHLYLQHNHLSGPLLAIFSE-----L 135 Query: 439 KELKHLDLNNNIIESVDSIRFS*LPSLRHL 528 K LK LDL+NN S L SL+ L Sbjct: 136 KNLKVLDLSNNGFNGSIPTSLSGLTSLQVL 165 Score = 28.3 bits (60), Expect = 6.1 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +1 Query: 283 FEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQ-QVSRHGLPFLKELKHLD 459 F L +LK+L L NN +L + L+ L+L+ N ++ LP +L ++ Sbjct: 132 FSELKNLKVLDLSNNGFNGSIPTSLSGLTSLQVLNLANNSFSGEIPNLHLP---KLSQIN 188 Query: 460 LNNN 471 L+NN Sbjct: 189 LSNN 192 >At5g05850.1 68418.m00643 leucine-rich repeat family protein contains Pfam PF00560: Leucine Rich Repeat domains; similar to (SP:Q9UQ13) Leucine-rich repeat protein SHOC-2 (Ras-binding protein Sur-8) (SP:Q9UQ13) {Homo sapiens} Length = 506 Score = 35.9 bits (79), Expect = 0.031 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 1/84 (1%) Frame = +1 Query: 247 LKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHG 426 L R + PE F + L +L+L NN + IP + G LE LD+S N ++ + Sbjct: 211 LSGRKLKLLPEAFGKIQGLLVLNLYNNQLQAIPDSIAGLHNLLE-LDVSTNFLETLP-DS 268 Query: 427 LPFLKELKHLDLNNNIIESV-DSI 495 + L +LK L+++ N + ++ DSI Sbjct: 269 IGLLSKLKILNVSCNKLTTLPDSI 292 >At1g75640.1 68414.m08788 leucine-rich repeat family protein / protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 1140 Score = 35.9 bits (79), Expect = 0.031 Identities = 23/76 (30%), Positives = 37/76 (48%) Frame = +1 Query: 250 KHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGL 429 K R+ P L L++++L NN + + ++ L+YL+LS NL Sbjct: 515 KQRISGQLPVELFGLPDLQVVALGNNLLGGVVPEGFSSLVSLKYLNLSSNLFSGHIPKNY 574 Query: 430 PFLKELKHLDLNNNII 477 FLK L+ L L++N I Sbjct: 575 GFLKSLQVLSLSHNRI 590 Score = 35.9 bits (79), Expect = 0.031 Identities = 27/85 (31%), Positives = 39/85 (45%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE F L SLK L+L +N N GF+ L+ L LS N I + L+ Sbjct: 547 PEGFSSLVSLKYLNLSSNLFSGHIPKNYGFLKSLQVLSLSHNRISGTIPPEIGNCSSLEV 606 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 L+L +N ++ + S L L+ L Sbjct: 607 LELGSNSLKGHIPVYVSKLSLLKKL 631 Score = 33.5 bits (73), Expect = 0.16 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 1/79 (1%) Frame = +1 Query: 247 LKHRLVTFE-PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L H +T P+ SSL+ L L +NS+ +L + +L LDLS N + Sbjct: 633 LSHNSLTGSIPDQISKDSSLESLLLNSNSLSGRIPESLSRLTNLTALDLSSNRLNSTIPS 692 Query: 424 GLPFLKELKHLDLNNNIIE 480 L L+ L + +L+ N +E Sbjct: 693 SLSRLRFLNYFNLSRNSLE 711 Score = 31.9 bits (69), Expect = 0.50 Identities = 23/83 (27%), Positives = 35/83 (42%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P F SSL++++L N A LG + LEYL L N +Q L L H Sbjct: 180 PANFSADSSLQLINLSFNHFSGEIPATLGQLQDLEYLWLDSNQLQGTIPSALANCSSLIH 239 Query: 454 LDLNNNIIESVDSIRFS*LPSLR 522 + N + + + + SL+ Sbjct: 240 FSVTGNHLTGLIPVTLGTIRSLQ 262 >At1g73080.1 68414.m08450 leucine-rich repeat transmembrane protein kinase, putative similar to receptor protein kinase GI:1389566 from [Arabidopsis thaliana] Length = 1123 Score = 35.9 bits (79), Expect = 0.031 Identities = 24/69 (34%), Positives = 34/69 (49%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ SSL+IL L N ++ +L + +L L + N +Q R G P K L Sbjct: 212 PESIGNSSSLQILYLHRNKLVGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLT 271 Query: 454 LDLNNNIIE 480 LDL+ N E Sbjct: 272 LDLSYNEFE 280 Score = 31.1 bits (67), Expect = 0.87 Identities = 26/68 (38%), Positives = 31/68 (45%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE E L SL+IL L N+ + LG L LDLSEN L LK L+ Sbjct: 93 PEIGE-LKSLQILDLSTNNFSGTIPSTLGNCTKLATLDLSENGFSDKIPDTLDSLKRLEV 151 Query: 454 LDLNNNII 477 L L N + Sbjct: 152 LYLYINFL 159 >At1g56145.1 68414.m06448 leucine-rich repeat family protein / protein kinase family protein contains Pfam profiles: PF00069: Eukaryotic protein kinase domain, multiple PF00560: Leucine Rich Repeat Length = 1012 Score = 35.9 bits (79), Expect = 0.031 Identities = 21/60 (35%), Positives = 32/60 (53%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 + S+ +L LRNN++ +N+G + L LDLS N + L ++L HL L NN Sbjct: 285 MKSISVLVLRNNNLTGTIPSNIGDYLGLRQLDLSFNKLTGQIPAPLFNSRQLTHLFLGNN 344 >At1g28340.1 68414.m03481 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains some similarity to receptor-like protein kinases Length = 626 Score = 35.9 bits (79), Expect = 0.031 Identities = 25/68 (36%), Positives = 32/68 (47%) Frame = +1 Query: 268 FEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKEL 447 F P L L+ ++L N+I A+LG V LE LDLS N L L L Sbjct: 436 FLPNDISKLKHLQSINLSENNIRGGIPASLGSVTSLEVLDLSYNSFNGSIPETLGELTSL 495 Query: 448 KHLDLNNN 471 + L+LN N Sbjct: 496 RILNLNGN 503 Score = 31.1 bits (67), Expect = 0.87 Identities = 16/43 (37%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSEN 399 PET L+SL+IL+L NS+ +P+A G ++H + ++N Sbjct: 486 PETLGELTSLRILNLNGNSLSGKVPAAVGGRLLHRASFNFTDN 528 >At5g56040.1 68418.m06992 leucine-rich repeat protein kinase, putative contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 953 Score = 35.5 bits (78), Expect = 0.040 Identities = 23/65 (35%), Positives = 35/65 (53%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 + SL +LSL + ++ LG + LE LDL++N + + LK+LK L LN N Sbjct: 95 IKSLTLLSLTSVNLTGSIPKELGDLSELEVLDLADNSLSGEIPVDIFKLKKLKILSLNTN 154 Query: 472 IIESV 486 +E V Sbjct: 155 NLEGV 159 Score = 28.7 bits (61), Expect = 4.6 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN-LIQQVSRHGLPFLKELKHLDL 462 L LKILSL N++ + + LG +++L L L +N L ++ R + ELK+L++ Sbjct: 143 LKKLKILSLNTNNLEGVIPSELGNLVNLIELTLFDNKLAGEIPR----TIGELKNLEI 196 >At3g19700.1 68416.m02495 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich receptor-like protein kinase GB:AAC36318 from [Malus domestica]; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 991 Score = 35.5 bits (78), Expect = 0.040 Identities = 21/76 (27%), Positives = 40/76 (52%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 +L++R PE++ +L L + NNS+ + + + + +L++LDL+ N + Sbjct: 371 MLQNRFTGQFPESYAKCKTLIRLRVSNNSLSGMIPSGIWGLPNLQFLDLASNYFEGNLTG 430 Query: 424 GLPFLKELKHLDLNNN 471 + K L LDL+NN Sbjct: 431 DIGNAKSLGSLDLSNN 446 Score = 31.1 bits (67), Expect = 0.87 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQ 408 + ++RL P+ F SL LSL N + LG +Y+D+SEN ++ Sbjct: 299 MFENRLTGEIPKEFGDFKSLAALSLYRNQLTGKLPRRLGSWTAFKYIDVSENFLE 353 >At2g34930.1 68415.m04288 disease resistance family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.1 [Lycopersicon pimpinellifolium] gi|1184075|gb|AAC15779 Length = 905 Score = 35.5 bits (78), Expect = 0.040 Identities = 24/76 (31%), Positives = 37/76 (48%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L ++L PE+ L +L+ L L +NS +++G + L+ LDLS N + Sbjct: 356 LSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAE 415 Query: 424 GLPFLKELKHLDLNNN 471 L L EL L+L N Sbjct: 416 SLGQLAELVDLNLMAN 431 Score = 33.1 bits (72), Expect = 0.22 Identities = 20/59 (33%), Positives = 30/59 (50%) Frame = +1 Query: 295 SSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 +SL L L +N + +LG + +L+ LDLS N + + LK LDL+NN Sbjct: 349 NSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNN 407 Score = 28.3 bits (60), Expect = 6.1 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGF-VIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNN 468 L L++L L NS L+ P N F + +L L L + +Q G LK L+ LDL+N Sbjct: 246 LKLLEVLDLSENS-LNSPIPNWLFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSN 304 Query: 469 NI 474 N+ Sbjct: 305 NL 306 >At1g60800.1 68414.m06844 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 632 Score = 35.5 bits (78), Expect = 0.040 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 1/75 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PET L L+ L L NNS A+LG + +L YL L+ N + L ++ L Sbjct: 115 PETIGRLEKLQSLDLSNNSFTGEIPASLGELKNLNYLRLNNNSLIGTCPESLSKIEGLTL 174 Query: 454 LDLN-NNIIESVDSI 495 +D++ NN+ S+ + Sbjct: 175 VDISYNNLSGSLPKV 189 Score = 33.1 bits (72), Expect = 0.22 Identities = 22/60 (36%), Positives = 31/60 (51%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L+ L+ + L+NN+I +G + L+ LDLS N L LK L +L LNNN Sbjct: 97 LTYLQSVVLQNNAITGPIPETIGRLEKLQSLDLSNNSFTGEIPASLGELKNLNYLRLNNN 156 >At1g56120.1 68414.m06444 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1045 Score = 35.5 bits (78), Expect = 0.040 Identities = 21/62 (33%), Positives = 31/62 (50%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 + SL +L LRNN++ + +G L+ +DLS N + L L L HL L NN Sbjct: 263 MKSLSVLVLRNNNLTGTIPSTIGGYTSLQQVDLSFNKLHGPIPASLFNLSRLTHLFLGNN 322 Query: 472 II 477 + Sbjct: 323 TL 324 >At5g53890.1 68418.m06703 leucine-rich repeat transmembrane protein kinase, putative Length = 1036 Score = 35.1 bits (77), Expect = 0.054 Identities = 22/71 (30%), Positives = 33/71 (46%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 LS LK L + N D+ G + LE+LD+S N L +L+ LDL NN Sbjct: 255 LSGLKSLLISENRFSDVIPDVFGNLTQLEHLDVSSNKFSGRFPPSLSQCSKLRVLDLRNN 314 Query: 472 IIESVDSIRFS 504 + ++ F+ Sbjct: 315 SLSGSINLNFT 325 Score = 33.1 bits (72), Expect = 0.22 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 3/68 (4%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIH---LEYLDLSENLIQQVSRHGLPFLKE 444 P+TF+ L SL LSL NNS +D S + + H L L LS+N I + + + Sbjct: 369 PDTFKNLQSLLFLSLSNNSFVDF-SETMNVLQHCRNLSTLILSKNFIGEEIPNNVTGFDN 427 Query: 445 LKHLDLNN 468 L L L N Sbjct: 428 LAILALGN 435 Score = 32.3 bits (70), Expect = 0.38 Identities = 23/73 (31%), Positives = 36/73 (49%) Frame = +1 Query: 253 HRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLP 432 +RL P+ + L+ LSL N + S NL + L+ L +SEN V Sbjct: 218 NRLTGQLPDYLYSIRELEQLSLSGNYLSGELSKNLSNLSGLKSLLISENRFSDVIPDVFG 277 Query: 433 FLKELKHLDLNNN 471 L +L+HLD+++N Sbjct: 278 NLTQLEHLDVSSN 290 Score = 29.9 bits (64), Expect = 2.0 Identities = 25/85 (29%), Positives = 33/85 (38%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + S L++L LRNNS+ + N L LDL+ N L ++K Sbjct: 297 PPSLSQCSKLRVLDLRNNSLSGSINLNFTGFTDLCVLDLASNHFSGPLPDSLGHCPKMKI 356 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 L L N F L SL L Sbjct: 357 LSLAKNEFRGKIPDTFKNLQSLLFL 381 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/60 (28%), Positives = 32/60 (53%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L+ L++L L N + A + + L+ LDLS NL+ + LK ++ L++++N Sbjct: 87 LTELRVLDLSRNQLKGEVPAEISKLEQLQVLDLSHNLLSGSVLGVVSGLKLIQSLNISSN 146 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/56 (30%), Positives = 31/56 (55%) Frame = +1 Query: 310 LSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNII 477 L L + + S +LG + L LDLS N ++ + L++L+ LDL++N++ Sbjct: 69 LVLPEKGLEGVISKSLGELTELRVLDLSRNQLKGEVPAEISKLEQLQVLDLSHNLL 124 Score = 28.3 bits (60), Expect = 6.1 Identities = 25/86 (29%), Positives = 38/86 (44%), Gaps = 1/86 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 P +L IL+L N + IPS L LE LDLS N H + ++ L Sbjct: 419 PNNVTGFDNLAILALGNCGLRGQIPSWLLNCK-KLEVLDLSWNHFYGTIPHWIGKMESLF 477 Query: 451 HLDLNNNIIESVDSIRFS*LPSLRHL 528 ++D +NN + + + L +L L Sbjct: 478 YIDFSNNTLTGAIPVAITELKNLIRL 503 >At4g20270.1 68417.m02961 leucine-rich repeat transmembrane protein kinase, putative CLAVATA1 receptor kinase, Arabidopsis th., PATX:G2160756 Length = 992 Score = 35.1 bits (77), Expect = 0.054 Identities = 28/83 (33%), Positives = 38/83 (45%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P F L +L L L N S+ A LG + +LE L L N + L + LK Sbjct: 240 PADFGRLINLVHLDLANCSLKGSIPAELGNLKNLEVLFLQTNELTGSVPRELGNMTSLKT 299 Query: 454 LDLNNNIIESVDSIRFS*LPSLR 522 LDL+NN +E + S L L+ Sbjct: 300 LDLSNNFLEGEIPLELSGLQKLQ 322 Score = 31.5 bits (68), Expect = 0.66 Identities = 23/68 (33%), Positives = 33/68 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE L L+IL L +N+ + LG +L +DLS N + + L F + LK Sbjct: 336 PEFVSELPDLQILKLWHNNFTGKIPSKLGSNGNLIEIDLSTNKLTGLIPESLCFGRRLKI 395 Query: 454 LDLNNNII 477 L L NN + Sbjct: 396 LILFNNFL 403 Score = 29.9 bits (64), Expect = 2.0 Identities = 24/78 (30%), Positives = 34/78 (43%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L ++L PE+ LKIL L NN + +LG L L +N + Sbjct: 374 LSTNKLTGLIPESLCFGRRLKILILFNNFLFGPLPEDLGQCEPLWRFRLGQNFLTSKLPK 433 Query: 424 GLPFLKELKHLDLNNNII 477 GL +L L L+L NN + Sbjct: 434 GLIYLPNLSLLELQNNFL 451 >At3g23120.1 68416.m02914 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-5b GB:AAC78595 [Lycopersicon esculentum] (Plant Cell 10, 1915-1926 (1998); Length = 784 Score = 35.1 bits (77), Expect = 0.054 Identities = 19/62 (30%), Positives = 35/62 (56%) Frame = +1 Query: 295 SSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNI 474 S L +L + +N+ + ++L +++LE LDLS N + +S + L L LD++ N Sbjct: 278 SRLTMLDISHNNFIGRVPSSLSKLVNLELLDLSHNNFRGLSPRSISKLVNLTSLDISYNK 337 Query: 475 IE 480 +E Sbjct: 338 LE 339 Score = 34.7 bits (76), Expect = 0.071 Identities = 22/66 (33%), Positives = 33/66 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + E LS L L L N ++ A++G + LEY+DL N ++ L +L Sbjct: 127 PSSIENLSHLTHLDLSTNHLVGEVPASIGNLNQLEYIDLRGNHLRGNIPTSFANLTKLSL 186 Query: 454 LDLNNN 471 LDL+ N Sbjct: 187 LDLHEN 192 Score = 29.1 bits (62), Expect = 3.5 Identities = 21/58 (36%), Positives = 28/58 (48%) Frame = +1 Query: 298 SLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 SLK+ L S S+ L + HL +LDLS +Q + L L HLDL+ N Sbjct: 87 SLKLYFLSTASTSLKSSSALFKLQHLTHLDLSNCNLQGEIPSSIENLSHLTHLDLSTN 144 >At3g20820.1 68416.m02633 leucine-rich repeat family protein contains similarity to Cf-2.1 [Lycopersicon pimpinellifolium] gi|1184075|gb|AAC15779; contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 365 Score = 35.1 bits (77), Expect = 0.054 Identities = 23/71 (32%), Positives = 33/71 (46%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+ L L+ L L N I ++G + L L++++N I L L L H Sbjct: 120 PKCITRLPFLRTLDLIGNQISGGIPYDIGRLNRLAVLNVADNRISGSIPKSLTNLSSLMH 179 Query: 454 LDLNNNIIESV 486 LDL NN+I V Sbjct: 180 LDLRNNLISGV 190 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/66 (33%), Positives = 32/66 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P++ LSSL L LRNN I + +++G + L LS N I L + L Sbjct: 168 PKSLTNLSSLMHLDLRNNLISGVIPSDVGRLKMLSRALLSGNRITGRIPESLTNIYRLAD 227 Query: 454 LDLNNN 471 +DL+ N Sbjct: 228 VDLSGN 233 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +2 Query: 17 TVLDISYNKILDLGSENFESNSEMRHLNLSNNFL 118 TVLD+SYN + + S + HL+LS+N L Sbjct: 297 TVLDLSYNNLKGPIPRSISGASFIGHLDLSHNHL 330 >At2g33030.1 68415.m04049 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611 Length = 218 Score = 35.1 bits (77), Expect = 0.054 Identities = 20/66 (30%), Positives = 36/66 (54%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L +L L+L NN+ + ++ +I LE LD+S N + GL L L + Sbjct: 52 PESIGLLKALIALNLSNNAFIGNIPMSMANLIELESLDMSRNGLSGTIPQGLKTLSFLGY 111 Query: 454 LDLNNN 471 +++++N Sbjct: 112 INVSHN 117 >At1g74360.1 68414.m08615 leucine-rich repeat transmembrane protein kinase, putative similar to brassinosteroid insensitive 1 GB:AAC49810 (putative receptor protein kinase); contains Pfam profiles: PF00560 Leucine Rich Repeat (17 repeats), PF00069 Eukaryotic protein kinase domain Length = 1106 Score = 35.1 bits (77), Expect = 0.054 Identities = 20/57 (35%), Positives = 31/57 (54%) Frame = +1 Query: 310 LSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNIIE 480 ++L +++I N + L YLDLS N I+ L LKHL+L++NI+E Sbjct: 92 INLTDSTISGPLFKNFSALTELTYLDLSRNTIEGEIPDDLSRCHNLKHLNLSHNILE 148 Score = 31.9 bits (69), Expect = 0.50 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 2/87 (2%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSI-LDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 P +SSLK L L NN+ DIP L + +L +LDLS N + ++K Sbjct: 293 PAEIGSISSLKGLYLGNNTFSRDIPETLLN-LTNLVFLDLSRNKFGGDIQEIFGRFTQVK 351 Query: 451 HLDLN-NNIIESVDSIRFS*LPSLRHL 528 +L L+ N+ + ++S LP+L L Sbjct: 352 YLVLHANSYVGGINSSNILKLPNLSRL 378 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +2 Query: 8 TQLTVLDISYNKILDLGSENFESNSEMRHLNLSNNFLK 121 T+LT LD+S N I ++ ++HLNLS+N L+ Sbjct: 111 TELTYLDLSRNTIEGEIPDDLSRCHNLKHLNLSHNILE 148 >At5g67280.1 68418.m08483 leucine-rich repeat transmembrane protein kinase, putative Length = 751 Score = 34.7 bits (76), Expect = 0.071 Identities = 25/74 (33%), Positives = 38/74 (51%) Frame = +1 Query: 307 ILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNIIESV 486 +LSL ++++ +NLG + L+ LDLS N I L EL+ LDL++N I Sbjct: 80 VLSLPSSNLTGTLPSNLGSLNSLQRLDLSNNSINGSFPVSLLNATELRFLDLSDNHISGA 139 Query: 487 DSIRFS*LPSLRHL 528 F L +L+ L Sbjct: 140 LPASFGALSNLQVL 153 Score = 33.5 bits (73), Expect = 0.16 Identities = 23/66 (34%), Positives = 32/66 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P L+SL+ L L NNSI +L L +LDLS+N I L L+ Sbjct: 93 PSNLGSLNSLQRLDLSNNSINGSFPVSLLNATELRFLDLSDNHISGALPASFGALSNLQV 152 Query: 454 LDLNNN 471 L+L++N Sbjct: 153 LNLSDN 158 >At5g65240.1 68418.m08207 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 617 Score = 34.7 bits (76), Expect = 0.071 Identities = 22/66 (33%), Positives = 36/66 (54%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ LSSL L L +N + D + LG + +L++L LS N + L L +L + Sbjct: 105 PESIGNLSSLTSLDLEDNHLTDRIPSTLGNLKNLQFLTLSRNNLNGSIPDSLTGLSKLIN 164 Query: 454 LDLNNN 471 + L++N Sbjct: 165 ILLDSN 170 >At5g40170.1 68418.m04875 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-4 [Lycopersicon hirsutum] gi|2808683|emb|CAA05268 Length = 792 Score = 34.7 bits (76), Expect = 0.071 Identities = 23/66 (34%), Positives = 35/66 (53%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L SL +L L NNS ++L + LE LDLS+N I L L L + Sbjct: 631 PESIGDLKSLIVLDLSNNSFTGRIPSSLAKLKQLESLDLSQNRISGNIPQELRELTFLGY 690 Query: 454 LDLNNN 471 +++++N Sbjct: 691 VNMSHN 696 >At5g21090.1 68418.m02511 leucine-rich repeat protein, putative similar to leucine rich repeat protein (LRP) GI:1619300 from [Lycopersicon esculentum]; contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611 Length = 218 Score = 34.7 bits (76), Expect = 0.071 Identities = 24/70 (34%), Positives = 35/70 (50%) Frame = +1 Query: 310 LSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNIIESVD 489 + L N+++ + LG + HL+YL+L +N IQ L LK L LDL NN + + Sbjct: 75 VDLGNSNLSGHLAPELGKLEHLQYLELYKNNIQGTIPSELGNLKNLISLDLYNNNLTGIV 134 Query: 490 SIRFS*LPSL 519 L SL Sbjct: 135 PTSLGKLKSL 144 Score = 30.3 bits (65), Expect = 1.5 Identities = 24/77 (31%), Positives = 36/77 (46%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L L+ L L N+I + LG + +L LDL N + + L LK L L LN+N Sbjct: 93 LEHLQYLELYKNNIQGTIPSELGNLKNLISLDLYNNNLTGIVPTSLGKLKSLVFLRLNDN 152 Query: 472 IIESVDSIRFS*LPSLR 522 + + +PSL+ Sbjct: 153 RLTGPIPRALTAIPSLK 169 >At3g43740.1 68416.m04672 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to somatic embryogenesis receptor-like kinase 2 [Arabidopsis thaliana] gi|14573457|gb|AAK68073 Length = 218 Score = 34.7 bits (76), Expect = 0.071 Identities = 24/62 (38%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +1 Query: 310 LSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDL-NNNIIESV 486 L L N+++ LG + HL+YL+L +N IQ L LK L LDL NNN+ + Sbjct: 75 LDLGNSNLSGHLVPELGKLEHLQYLELYKNEIQGTIPSELGNLKSLISLDLYNNNLTGKI 134 Query: 487 DS 492 S Sbjct: 135 PS 136 Score = 30.7 bits (66), Expect = 1.2 Identities = 22/76 (28%), Positives = 36/76 (47%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L K+ + P L SL L L NN++ ++LG + L +L L+EN + Sbjct: 101 LYKNEIQGTIPSELGNLKSLISLDLYNNNLTGKIPSSLGKLKSLVFLRLNENRLTGPIPR 160 Query: 424 GLPFLKELKHLDLNNN 471 L + LK +D++ N Sbjct: 161 ELTVISSLKVVDVSGN 176 >At3g25010.1 68416.m03126 disease resistance family protein contains leucine rich-repeat (LRR) domains (23 copies) Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596 Length = 881 Score = 34.7 bits (76), Expect = 0.071 Identities = 20/66 (30%), Positives = 36/66 (54%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L +L L+L NN+ +L ++ +E LDLS N + +GL L L + Sbjct: 718 PESIGLLKALIALNLSNNAFTGHIPLSLANLVKIESLDLSSNQLSGTIPNGLGTLSFLAY 777 Query: 454 LDLNNN 471 +++++N Sbjct: 778 VNVSHN 783 >At3g24240.1 68416.m03042 leucine-rich repeat transmembrane protein kinase, putative similar to CLV1 receptor kinase GB:AAB58929 from [Arabidopsis thaliana] Length = 1141 Score = 34.7 bits (76), Expect = 0.071 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 1/80 (1%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSR 420 L+ + L F P+ SSL L L N I +IPS +G + + +LD S N + Sbjct: 449 LISNSLSGFIPQEIGNCSSLVRLRLGFNRITGEIPSG-IGSLKKINFLDFSSNRLHGKVP 507 Query: 421 HGLPFLKELKHLDLNNNIIE 480 + EL+ +DL+NN +E Sbjct: 508 DEIGSCSELQMIDLSNNSLE 527 >At2g33060.1 68415.m04054 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 808 Score = 34.7 bits (76), Expect = 0.071 Identities = 22/66 (33%), Positives = 33/66 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L +L L+L NN+ +L V LE LDLS N + +GL L L + Sbjct: 619 PESIGLLKALIALNLSNNAFTGHIPLSLANVTELESLDLSRNQLSGTIPNGLKTLSFLAY 678 Query: 454 LDLNNN 471 + + +N Sbjct: 679 ISVAHN 684 >At2g25470.1 68415.m03050 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to disease resistance protein [Lycopersicon esculentum] gi|3894383|gb|AAC78591 Length = 910 Score = 34.7 bits (76), Expect = 0.071 Identities = 21/71 (29%), Positives = 36/71 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P L L+ L+L +NS+L ++ +I +E LDLS N++Q L L L Sbjct: 738 PTELGDLLKLRTLNLSHNSLLGSIPSSFSKLIDVESLDLSHNMLQGSIPQLLSSLTSLAV 797 Query: 454 LDLNNNIIESV 486 D+++N + + Sbjct: 798 FDVSSNNLSGI 808 >At1g73070.1 68414.m08449 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to receptor-like protein kinase INRPK1 [Ipomoea nil] gi|14495542|gb|AAB36558 Length = 598 Score = 34.7 bits (76), Expect = 0.071 Identities = 23/60 (38%), Positives = 31/60 (51%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L SL+IL + +N+ I ++LG L Y+DLSEN L LK L L L +N Sbjct: 96 LKSLEILDMSSNNFSGIIPSSLGNCSSLVYIDLSENSFSGKVPDTLGSLKSLADLYLYSN 155 Score = 34.3 bits (75), Expect = 0.094 Identities = 25/87 (28%), Positives = 41/87 (47%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L ++ L F P+ F L L L +NS +LG +L ++LS N + + Sbjct: 488 LRENNLSGFLPK-FSKNQDLSFLDLNSNSFEGPIPRSLGSCRNLTTINLSRNKLTRNIPR 546 Query: 424 GLPFLKELKHLDLNNNIIESVDSIRFS 504 L L+ L HL+L +N++ +FS Sbjct: 547 ELENLQNLSHLNLGSNLLNGTVPSKFS 573 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLD-LSENLIQQVSRH 423 PE L +LKI++L NNS + NLG +LE +D + N ++ R+ Sbjct: 402 PEEITKLKNLKIVTLFNNSFYGVIPPNLGLNSNLEIIDFIGNNFTGEIPRN 452 Score = 28.7 bits (61), Expect = 4.6 Identities = 21/66 (31%), Positives = 31/66 (46%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+T L SL L L +NS+ +L + L YL + N + + + KEL H Sbjct: 138 PDTLGSLKSLADLYLYSNSLTGELPKSLFRIPVLNYLHVEHNNLTGLIPQNVGEAKELLH 197 Query: 454 LDLNNN 471 L L +N Sbjct: 198 LRLFDN 203 >At4g37250.1 68417.m05273 leucine-rich repeat family protein / protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 768 Score = 34.3 bits (75), Expect = 0.094 Identities = 21/61 (34%), Positives = 34/61 (55%) Frame = +1 Query: 295 SSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNI 474 S + LSL N+ +L ++LG ++ L+ LDLS N +EL+ LDL++N+ Sbjct: 66 SKVLTLSLPNSQLLGSIPSDLGSLLTLQSLDLSNNSFNGPLPVSFFNARELRFLDLSSNM 125 Query: 475 I 477 I Sbjct: 126 I 126 Score = 29.5 bits (63), Expect = 2.7 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 P +F L+ L L +N I +IPSA +G + +L L+LS+N + L L+ L Sbjct: 107 PVSFFNARELRFLDLSSNMISGEIPSA-IGDLHNLLTLNLSDNALAGKLPTNLASLRNLT 165 Query: 451 HLDLNNN 471 + L NN Sbjct: 166 VVSLENN 172 Score = 27.9 bits (59), Expect = 8.1 Identities = 20/68 (29%), Positives = 30/68 (44%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P L +L+ L L NNS + L +LDLS N+I + L L Sbjct: 83 PSDLGSLLTLQSLDLSNNSFNGPLPVSFFNARELRFLDLSSNMISGEIPSAIGDLHNLLT 142 Query: 454 LDLNNNII 477 L+L++N + Sbjct: 143 LNLSDNAL 150 >At3g47110.1 68416.m05115 leucine-rich repeat transmembrane protein kinase, putative protein kinase Xa21 receptor type precursor, Oryza sativa, PIR:A57676 Length = 1025 Score = 34.3 bits (75), Expect = 0.094 Identities = 24/76 (31%), Positives = 37/76 (48%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 LS L+ L+L +N + +G + L+YL++S NL V L L LDL++N Sbjct: 104 LSFLRSLNLADNFFHGAIPSEVGNLFRLQYLNMSNNLFGGVIPVVLSNCSSLSTLDLSSN 163 Query: 472 IIESVDSIRFS*LPSL 519 +E + F L L Sbjct: 164 HLEQGVPLEFGSLSKL 179 Score = 27.9 bits (59), Expect = 8.1 Identities = 20/59 (33%), Positives = 29/59 (49%) Frame = +1 Query: 295 SSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 + L LSL N I +G ++ L+ LDL ENL+ L L EL+ + L +N Sbjct: 377 TQLTELSLGGNLISGSIPHGIGNLVSLQTLDLGENLLTGKLPPSLGELSELRKVLLYSN 435 >At3g26500.1 68416.m03305 leucine-rich repeat family protein Length = 471 Score = 34.3 bits (75), Expect = 0.094 Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 1/72 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVS-RHGLPFLKELK 450 P + + +LK L N I IP++ +G + LE L+LS N + + L L+ Sbjct: 292 PGSISEMYNLKYLDAHMNEIHGIPNS-IGRLTKLEVLNLSSNFNNLMGVPDTITDLTNLR 350 Query: 451 HLDLNNNIIESV 486 LDL+NN I+++ Sbjct: 351 ELDLSNNQIQAI 362 Score = 31.9 bits (69), Expect = 0.50 Identities = 18/75 (24%), Positives = 40/75 (53%) Frame = +1 Query: 262 VTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLK 441 +TF P+ L L+ L + +NS+ +P ++G +++L L+++ N + + + + Sbjct: 195 LTFIPDAISKLKKLEELDVSSNSLESLPD-SIGMLLNLRILNVNANNLTALP-ESIAHCR 252 Query: 442 ELKHLDLNNNIIESV 486 L LD + N + S+ Sbjct: 253 SLVELDASYNNLTSL 267 Score = 28.3 bits (60), Expect = 6.1 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 4/61 (6%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLI----QQVSRHGLPFLK 441 P+T L++L+ L L NN I IP + + LE L+L +N + Q+V+ G ++ Sbjct: 340 PDTITDLTNLRELDLSNNQIQAIPD-SFYRLRKLEKLNLDQNPLEIPSQEVATQGAEVVR 398 Query: 442 E 444 E Sbjct: 399 E 399 >At3g05360.1 68416.m00584 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to elicitor-inducible LRR receptor-like protein EILP [Nicotiana tabacum] gi|6635236|dbj|BAA88636; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 786 Score = 34.3 bits (75), Expect = 0.094 Identities = 21/69 (30%), Positives = 35/69 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L L++L+L NS +L + +LE LDLS N + L L L Sbjct: 615 PESVGLLKELRLLNLSGNSFTSNIPQSLANLTNLETLDLSRNQLSGHIPRDLGSLSFLST 674 Query: 454 LDLNNNIIE 480 ++ ++N++E Sbjct: 675 MNFSHNLLE 683 Score = 31.1 bits (67), Expect = 0.87 Identities = 18/31 (58%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +2 Query: 521 VIWDLSDNNMT-LIPTSALSKLSNLSHLYLS 610 ++ DLS NN+ IPTS +SKL NL HL LS Sbjct: 308 IVLDLSHNNLVGPIPTS-ISKLVNLQHLSLS 337 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 14 LTVLDISYNKILDLGSENFESNSEMRHLNLSNNFLK 121 L VLD+S+N ++ + ++HL+LSNN L+ Sbjct: 307 LIVLDLSHNNLVGPIPTSISKLVNLQHLSLSNNTLE 342 >At2g24230.1 68415.m02894 leucine-rich repeat transmembrane protein kinase, putative Length = 853 Score = 34.3 bits (75), Expect = 0.094 Identities = 24/75 (32%), Positives = 37/75 (49%) Frame = +1 Query: 247 LKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHG 426 L + ++ P F L++LK L+L N I S+N+G LE LD+S N Sbjct: 99 LSNNKISALPSDFWSLNTLKNLNLSFNKISGSFSSNVGNFGQLELLDISYNNFSGAIPEA 158 Query: 427 LPFLKELKHLDLNNN 471 + L L+ L L++N Sbjct: 159 VDSLVSLRVLKLDHN 173 Score = 28.7 bits (61), Expect = 4.6 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 4/90 (4%) Frame = +1 Query: 280 TFEPLSSLKILSLRNNSILDIP----SANLGFVIHLEYLDLSENLIQQVSRHGLPFLKEL 447 T LS L+ L L NN I +P S N ++L + +S + V G L ++ Sbjct: 87 TIGKLSKLQSLDLSNNKISALPSDFWSLNTLKNLNLSFNKISGSFSSNVGNFGQLELLDI 146 Query: 448 KHLDLNNNIIESVDSIRFS*LPSLRHLGPQ 537 + + + I E+VDS+ + L H G Q Sbjct: 147 SYNNFSGAIPEAVDSLVSLRVLKLDHNGFQ 176 >At2g23300.1 68415.m02781 leucine-rich repeat transmembrane protein kinase, putative Length = 773 Score = 34.3 bits (75), Expect = 0.094 Identities = 23/78 (29%), Positives = 42/78 (53%) Frame = +1 Query: 295 SSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNI 474 S + LSL N++++ ++LGF+ +L+ L+LS N + +L+ LDL+NN+ Sbjct: 75 SRVVTLSLPNSNLVGSIPSDLGFLQNLQSLNLSNNSLNGSLPVEFFAADKLRFLDLSNNL 134 Query: 475 IESVDSIRFS*LPSLRHL 528 I + L +L+ L Sbjct: 135 ISGEIPVSIGGLHNLQTL 152 Score = 31.5 bits (68), Expect = 0.66 Identities = 24/72 (33%), Positives = 34/72 (47%) Frame = +1 Query: 259 LVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFL 438 LV P L +L+ L+L NNS+ L +LDLS NLI + L Sbjct: 87 LVGSIPSDLGFLQNLQSLNLSNNSLNGSLPVEFFAADKLRFLDLSNNLISGEIPVSIGGL 146 Query: 439 KELKHLDLNNNI 474 L+ L+L++NI Sbjct: 147 HNLQTLNLSDNI 158 Score = 30.7 bits (66), Expect = 1.2 Identities = 20/66 (30%), Positives = 30/66 (45%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P F L+ L L NN I ++G + +L+ L+LS+N+ L L L Sbjct: 116 PVEFFAADKLRFLDLSNNLISGEIPVSIGGLHNLQTLNLSDNIFTGKLPANLASLGSLTE 175 Query: 454 LDLNNN 471 + L NN Sbjct: 176 VSLKNN 181 >At1g56130.1 68414.m06445 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1032 Score = 34.3 bits (75), Expect = 0.094 Identities = 21/62 (33%), Positives = 31/62 (50%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 + SL +L LRNN++ + +G L +DLS N + L L +L HL L NN Sbjct: 290 MKSLSVLVLRNNNLTGTIPSTIGEHSSLRQVDLSFNKLHGPIPASLFNLSQLTHLFLGNN 349 Query: 472 II 477 + Sbjct: 350 TL 351 >At5g46330.1 68418.m05703 leucine-rich repeat transmembrane protein kinase, putative Length = 1173 Score = 33.9 bits (74), Expect = 0.12 Identities = 22/65 (33%), Positives = 30/65 (46%) Frame = +1 Query: 277 ETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHL 456 E F+ + + L+L NS + G + HL LDLS N + L L LKHL Sbjct: 692 EVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHL 751 Query: 457 DLNNN 471 L +N Sbjct: 752 KLASN 756 Score = 31.9 bits (69), Expect = 0.50 Identities = 20/62 (32%), Positives = 31/62 (50%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L+ L++L L +NS A +G + L L L N G+ LK + +LDL NN Sbjct: 95 LTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPSGIWELKNIFYLDLRNN 154 Query: 472 II 477 ++ Sbjct: 155 LL 156 Score = 31.1 bits (67), Expect = 0.87 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 2/70 (2%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQ-QVSRHGLPFLKELK 450 P F L SL LSL+ N A+L + L D+S+NL+ + L LK ++ Sbjct: 568 PALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQ 627 Query: 451 -HLDLNNNII 477 +L+ +NN++ Sbjct: 628 LYLNFSNNLL 637 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = +2 Query: 488 IQLGFHSCLHYVIWDLSDNNMTLIPTSALSKLSNLSHLYLS 610 I F + H V DLS NN+T +L+ LS L HL L+ Sbjct: 714 IPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLA 754 Score = 28.7 bits (61), Expect = 4.6 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 2/69 (2%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILD-IPSANLGFVIHLE-YLDLSENLIQQVSRHGLPFLKEL 447 P + + LS L + +N + IP L + +++ YL+ S NL+ L L+ + Sbjct: 592 PASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLTGTIPKELGKLEMV 651 Query: 448 KHLDLNNNI 474 + +DL+NN+ Sbjct: 652 QEIDLSNNL 660 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 8 TQLTVLDISYNKILDLGSENFESNSEMRHLNLSNNFLK 121 T L LD+S N + E+ + S ++HL L++N LK Sbjct: 722 THLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLK 759 >At5g20480.1 68418.m02434 leucine-rich repeat transmembrane protein kinase, putative protein kinase Xa21, Oryza sativa, PIR:A57676 Length = 1031 Score = 33.9 bits (74), Expect = 0.12 Identities = 19/60 (31%), Positives = 33/60 (55%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 LS L++L+L +NS +G + L+YL++S NL++ L L +DL++N Sbjct: 96 LSFLRLLNLADNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSN 155 Score = 30.7 bits (66), Expect = 1.2 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 1/87 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVI-HLEYLDLSENLIQQVSRHGLPFLKELK 450 P +SSL+ LSL +NS A+ G+++ +L L L N L + L+ Sbjct: 234 PPALYNISSLESLSLADNSFSGNLRADFGYLLPNLRRLLLGTNQFTGAIPKTLANISSLE 293 Query: 451 HLDLNNNIIESVDSIRFS*LPSLRHLG 531 D+++N + + F L +L LG Sbjct: 294 RFDISSNYLSGSIPLSFGKLRNLWWLG 320 >At4g22730.1 68417.m03279 leucine-rich repeat transmembrane protein kinase, putative leucine rich repeat receptor-like kinase, Oryza sativa, PATCHX:E267533 Length = 688 Score = 33.9 bits (74), Expect = 0.12 Identities = 22/68 (32%), Positives = 33/68 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+ L L +LSL++N + LG + L LDLS N + + L + +L Sbjct: 157 PKNIGSLKKLNVLSLQHNKLTGEVPWTLGNLSMLSRLDLSFNNLLGLIPKTLANIPQLDT 216 Query: 454 LDLNNNII 477 LDL NN + Sbjct: 217 LDLRNNTL 224 >At3g59510.1 68416.m06641 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; contains some similarity to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596 Length = 419 Score = 33.9 bits (74), Expect = 0.12 Identities = 27/79 (34%), Positives = 36/79 (45%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L+ L +LSL N ++ + L L L+EN + LKELK +DL+ N Sbjct: 118 LTELTVLSLNKNRFRGPVPESVFQLRKLTKLSLAENFFTGDIPAEITRLKELKTIDLSKN 177 Query: 472 IIESVDSIRFS*LPSLRHL 528 I R S L SL HL Sbjct: 178 SIAGEIPPRISALRSLTHL 196 Score = 32.3 bits (70), Expect = 0.38 Identities = 28/80 (35%), Positives = 40/80 (50%), Gaps = 1/80 (1%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSR 420 L K+R PE+ L L LSL N DIP A + + L+ +DLS+N I Sbjct: 126 LNKNRFRGPVPESVFQLRKLTKLSLAENFFTGDIP-AEITRLKELKTIDLSKNSIAGEIP 184 Query: 421 HGLPFLKELKHLDLNNNIIE 480 + L+ L HL L+NN ++ Sbjct: 185 PRISALRSLTHLVLSNNHLD 204 >At2g23950.1 68415.m02860 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 634 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 P + LS+L+ L L NNS+ A+L + HL +LDLS N Sbjct: 139 PGSVNQLSNLQYLRLNNNSLSGPFPASLSQIPHLSFLDLSYN 180 >At5g67200.1 68418.m08471 leucine-rich repeat transmembrane protein kinase, putative Length = 669 Score = 33.5 bits (73), Expect = 0.16 Identities = 21/68 (30%), Positives = 33/68 (48%) Frame = +1 Query: 268 FEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKEL 447 F T L L++LSL NNS+ P +L +++L+ L LS N + L L Sbjct: 88 FSSATLSRLDQLRVLSLENNSLFG-PIPDLSHLVNLKSLFLSRNQFSGAFPPSILSLHRL 146 Query: 448 KHLDLNNN 471 L +++N Sbjct: 147 MILSISHN 154 >At4g26540.1 68417.m03823 protein kinase family protein Three false introns were added with non-consensus splice sites to circumenvent frameshifts likely due to sequencing errors; this is extremely unusual and is under investigation. Length = 1089 Score = 33.5 bits (73), Expect = 0.16 Identities = 22/63 (34%), Positives = 33/63 (52%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L SL L+L + ++ + +G LE LDLS+N + + LK+LK L LN N Sbjct: 92 LKSLTSLTLSSLNLTGVIPKEIGDFTELELLDLSDNSLSGDIPVEIFRLKKLKTLSLNTN 151 Query: 472 IIE 480 +E Sbjct: 152 NLE 154 Score = 27.9 bits (59), Expect = 8.1 Identities = 20/78 (25%), Positives = 34/78 (43%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L ++ LV P L ++ N + + G + +L+ L LS N I Sbjct: 293 LWQNNLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLENLQELQLSVNQISGTIPE 352 Query: 424 GLPFLKELKHLDLNNNII 477 L +L HL+++NN+I Sbjct: 353 ELTNCTKLTHLEIDNNLI 370 >At4g03260.1 68417.m00445 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 677 Score = 33.5 bits (73), Expect = 0.16 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +2 Query: 8 TQLTVLDISYNKILDLGSENFESNSEMRHLNLSNNFLKRLD 130 T+L VLD+SYN+IL LG S S ++ L L+ N + ++ Sbjct: 463 TRLRVLDLSYNRILRLG-HGLASCSSLKELYLAGNKISEIE 502 >At3g51740.1 68416.m05673 leucine-rich repeat transmembrane protein kinase, putative brassinosteroid-insensitive protein BRI1 - Arabidopsis thaliana, PIR:T09356 Length = 836 Score = 33.5 bits (73), Expect = 0.16 Identities = 23/79 (29%), Positives = 36/79 (45%) Frame = +2 Query: 14 LTVLDISYNKILDLGSENFESNSEMRHLNLSNNFLKRLDKDAFVGXXXXXXXXXXXXEIS 193 L LD SYN I ++F + S + LNL +N LK DA +I+ Sbjct: 289 LQSLDFSYNSINGTIPDSFSNLSSLVSLNLESNHLKGPIPDAIDRLHNLTELNLKRNKIN 348 Query: 194 NIHVQTFRDLSALERLDFS 250 +T ++S +++LD S Sbjct: 349 GPIPETIGNISGIKKLDLS 367 Score = 27.9 bits (59), Expect = 8.1 Identities = 21/65 (32%), Positives = 31/65 (47%) Frame = +1 Query: 277 ETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHL 456 E L SL+ LSL NN I +LG++ L + L N + L L++L Sbjct: 112 EKIGQLGSLRKLSLHNNVIAGSVPRSLGYLKSLRGVYLFNNRLSGSIPVSLGNCPLLQNL 171 Query: 457 DLNNN 471 DL++N Sbjct: 172 DLSSN 176 >At3g02130.1 68416.m00180 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profile: Eukaryotic protein kinase domain Length = 985 Score = 33.5 bits (73), Expect = 0.16 Identities = 21/60 (35%), Positives = 31/60 (51%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 +++L LS+ NN++ + G + L+ LDLS N + H LK L L LNNN Sbjct: 492 MAALTYLSIANNNLTGQIPQSFGQLHSLDVLDLSSNHLSGGIPHDFVNLKNLTVLLLNNN 551 >At2g32660.1 68415.m03992 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-4 [Lycopersicon hirsutum] gi|2808683|emb|CAA05268 Length = 589 Score = 33.5 bits (73), Expect = 0.16 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 1/67 (1%) Frame = +1 Query: 283 FEPLSSLKILSLRNNSI-LDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLD 459 F PL SL L L NS+ L +++ F ++E L LS I + R L LK+L +LD Sbjct: 70 FSPLQSLTHLDLHGNSLTLTSVYSDIDFPKNMEILLLSGCNISEFPRF-LKSLKKLWYLD 128 Query: 460 LNNNIIE 480 L++N I+ Sbjct: 129 LSSNRIK 135 Score = 32.3 bits (70), Expect = 0.38 Identities = 22/66 (33%), Positives = 32/66 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L +L L+L NNS + V LE LDLS N + L L L + Sbjct: 424 PESIGLLKTLIALNLSNNSFTGHIPMSFANVTELESLDLSGNKLSGEIPQELGRLSYLAY 483 Query: 454 LDLNNN 471 +D+++N Sbjct: 484 IDVSDN 489 >At1g74180.1 68414.m08591 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 951 Score = 33.5 bits (73), Expect = 0.16 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = +1 Query: 310 LSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNIIE 480 L L +N + + A LG + L L+LS NL+ LK+++ LDL+ N+++ Sbjct: 763 LDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSSIPANFSKLKDIESLDLSYNMLQ 819 Score = 28.7 bits (61), Expect = 4.6 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Frame = +1 Query: 253 HRLVTFEPETFEPLSSLKILSLRNNSILD--IPSANLGFVIHLEYLDLSENLI 405 +RL + P SS I+ L +N++L+ +P + L + HL +LDLS NL+ Sbjct: 536 NRLTGLISSSIPPDSSHLIMLLLSNNLLEGTLPPSLLA-IHHLNFLDLSGNLL 587 >At1g12460.1 68414.m01440 leucine-rich repeat transmembrane protein kinase, putative Length = 882 Score = 33.5 bits (73), Expect = 0.16 Identities = 19/65 (29%), Positives = 33/65 (50%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L+++KIL L N + LG + +++LDLS+N + L L L H +++ N Sbjct: 403 LTNIKILDLHRNRLNGSIPPELGNLSKVQFLDLSQNSLSGPIPSSLGSLNTLTHFNVSYN 462 Query: 472 IIESV 486 + V Sbjct: 463 NLSGV 467 >At5g58150.1 68418.m07278 leucine-rich repeat transmembrane protein kinase, putative Length = 785 Score = 33.1 bits (72), Expect = 0.22 Identities = 24/70 (34%), Positives = 34/70 (48%) Frame = +1 Query: 262 VTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLK 441 +T P LS L+ L+L +N I + +N+G + L LDLS N I + L Sbjct: 102 ITSLPSDLWSLSLLESLNLSSNRISEPLPSNIGNFMSLHTLDLSFNSISGKIPAAISNLV 161 Query: 442 ELKHLDLNNN 471 L L L+NN Sbjct: 162 NLTTLKLHNN 171 Score = 28.3 bits (60), Expect = 6.1 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 2/65 (3%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFL--KELKHLDLN 465 LS+L L+L ++ +I + + HL+ LDLS N ++ H +P L K ++ LDL+ Sbjct: 307 LSALHYLNLSRTNLTNIIPREISRLSHLKVLDLSSN---NLTGH-VPMLSVKNIEVLDLS 362 Query: 466 NNIIE 480 N ++ Sbjct: 363 LNKLD 367 >At5g07180.1 68418.m00818 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 932 Score = 33.1 bits (72), Expect = 0.22 Identities = 21/79 (26%), Positives = 39/79 (49%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L +L+ + L+ N + +G + L Y+D S NL+ + LK+L+ L+L NN Sbjct: 61 LMNLQSIDLQGNKLGGQIPDEIGNCVSLAYVDFSTNLLFGDIPFSISKLKQLEFLNLKNN 120 Query: 472 IIESVDSIRFS*LPSLRHL 528 + + +P+L+ L Sbjct: 121 QLTGPIPATLTQIPNLKTL 139 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/68 (27%), Positives = 35/68 (51%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + L L+ L+L+NN + A L + +L+ LDL+ N + L + + L++ Sbjct: 103 PFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEIPRLLYWNEVLQY 162 Query: 454 LDLNNNII 477 L L N++ Sbjct: 163 LGLRGNML 170 >At3g56100.1 68416.m06235 leucine-rich repeat transmembrane protein kinase, putative hypothetical proteins - Arabidopsis thaliana Length = 719 Score = 33.1 bits (72), Expect = 0.22 Identities = 24/85 (28%), Positives = 41/85 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + + +L+ + L NN + A+LG L+ LDLS NL+ ++ L +L Sbjct: 142 PMSLGLIPNLRGVQLFNNRLTGSIPASLGVSHFLQTLDLSNNLLSEIIPPNLADSSKLLR 201 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 L+L+ N + + S SL+ L Sbjct: 202 LNLSFNSLSGQIPVSLSRSSSLQFL 226 >At3g47580.1 68416.m05180 leucine-rich repeat transmembrane protein kinase, putative protein kinase Xa21 - Oryza sativa, PIR:A57676 Length = 1011 Score = 33.1 bits (72), Expect = 0.22 Identities = 23/72 (31%), Positives = 35/72 (48%) Frame = +1 Query: 232 RKT*LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQ 411 R+ L ++ LV P T +S+L+ + N + N G V L+YLDLSEN + Sbjct: 262 RELNLGENDLVGAIPTTLSNISTLQKFGINKNMMTGGIYPNFGKVPSLQYLDLSENPLGS 321 Query: 412 VSRHGLPFLKEL 447 + L F+ L Sbjct: 322 YTFGDLEFIDSL 333 >At2g15080.2 68415.m01719 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 983 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/66 (27%), Positives = 38/66 (57%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P++ L L +L+L NN++ ++++G ++ LE LD+S+N + L L L + Sbjct: 811 PKSIGLLKELHVLNLSNNALSGHIASSMGNLMALESLDVSQNKLSGEIPQELGKLTYLAY 870 Query: 454 LDLNNN 471 ++ ++N Sbjct: 871 MNFSHN 876 Score = 27.9 bits (59), Expect = 8.1 Identities = 21/66 (31%), Positives = 27/66 (40%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + LS L L L NS ++LG + HL L L N L L L Sbjct: 201 PSSIGNLSYLTTLRLSRNSFFGELPSSLGSLFHLTDLILDTNHFVGKIPSSLGNLSHLTS 260 Query: 454 LDLNNN 471 +DL+ N Sbjct: 261 IDLHKN 266 >At2g15080.1 68415.m01718 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 983 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/66 (27%), Positives = 38/66 (57%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P++ L L +L+L NN++ ++++G ++ LE LD+S+N + L L L + Sbjct: 811 PKSIGLLKELHVLNLSNNALSGHIASSMGNLMALESLDVSQNKLSGEIPQELGKLTYLAY 870 Query: 454 LDLNNN 471 ++ ++N Sbjct: 871 MNFSHN 876 Score = 27.9 bits (59), Expect = 8.1 Identities = 21/66 (31%), Positives = 27/66 (40%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + LS L L L NS ++LG + HL L L N L L L Sbjct: 201 PSSIGNLSYLTTLRLSRNSFFGELPSSLGSLFHLTDLILDTNHFVGKIPSSLGNLSHLTS 260 Query: 454 LDLNNN 471 +DL+ N Sbjct: 261 IDLHKN 266 >At1g13910.1 68414.m01632 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Hcr2-0A [Lycopersicon esculentum] gi|3894385|gb|AAC78592 Length = 330 Score = 33.1 bits (72), Expect = 0.22 Identities = 32/89 (35%), Positives = 44/89 (49%), Gaps = 4/89 (4%) Frame = +1 Query: 274 PETFEPLSSLKILSLR-NNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 P L SL L L NN +IP L + L+YL + EN L L++L+ Sbjct: 142 PPEIGGLKSLTYLYLSFNNFKGEIPK-ELANLHELQYLHIQENHFTGRIPAELGTLQKLR 200 Query: 451 HLDL-NNNIIESV-DSIRF-S*LPSLRHL 528 HLD NNN++ S+ D R P+LR+L Sbjct: 201 HLDAGNNNLVGSISDLFRIEGCFPALRNL 229 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/66 (28%), Positives = 30/66 (45%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+ L L +L + NN + +G + L L+L N +QQ + LK L + Sbjct: 94 PKAITKLLDLTVLDMHNNKLTGPIPPEIGRLKRLITLNLRWNKLQQALPPEIGGLKSLTY 153 Query: 454 LDLNNN 471 L L+ N Sbjct: 154 LYLSFN 159 >At5g51350.1 68418.m06367 leucine-rich repeat transmembrane protein kinase, putative Length = 895 Score = 32.7 bits (71), Expect = 0.29 Identities = 30/85 (35%), Positives = 41/85 (48%), Gaps = 1/85 (1%) Frame = +1 Query: 268 FEPETFEPLSSLKILSL-RNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKE 444 F P+ F L+ L+ L L RN+ +IP LG + L LDLS+N I LK Sbjct: 264 FLPKHFSNLTKLESLFLFRNHLSREIPW-ELGEITSLVNLDLSDNHISGTIPESFSGLKN 322 Query: 445 LKHLDLNNNIIESVDSIRFS*LPSL 519 L+ L+L N + + LPSL Sbjct: 323 LRLLNLMFNEMSGTLPEVIAQLPSL 347 Score = 30.7 bits (66), Expect = 1.2 Identities = 22/85 (25%), Positives = 36/85 (42%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P L +LK+L+L + + G +LE+L L NL+ L L L H Sbjct: 170 PIHLSQLENLKVLNLAGSYFTGSIPSQYGSFKNLEFLHLGGNLLSGHIPQELGNLTTLTH 229 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 +++ N E V + L++L Sbjct: 230 MEIGYNSYEGVIPWEIGYMSELKYL 254 Score = 28.3 bits (60), Expect = 6.1 Identities = 20/85 (23%), Positives = 36/85 (42%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + +L+ L L N + LG + L ++++ N + V + ++ ELK+ Sbjct: 194 PSQYGSFKNLEFLHLGGNLLSGHIPQELGNLTTLTHMEIGYNSYEGVIPWEIGYMSELKY 253 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 LD+ + FS L L L Sbjct: 254 LDIAGANLSGFLPKHFSNLTKLESL 278 >At5g49780.1 68418.m06165 leucine-rich repeat transmembrane protein kinase, putative Length = 1006 Score = 32.7 bits (71), Expect = 0.29 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 8/93 (8%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQ-------QVSRHGLP 432 PE+ L L LSL +N A++G + L + D+++N I+ S GL Sbjct: 207 PESIGSLEQLVTLSLNSNKFNGTIPASIGLLSKLYWFDIADNQIEGKLPVSDGASLPGLD 266 Query: 433 FLKELKHLDLNNNIIE-SVDSIRFS*LPSLRHL 528 L + KH N + + FS +L+HL Sbjct: 267 MLLQTKHFHFGKNKLSGDIPEKLFSANMTLKHL 299 >At5g37450.1 68418.m04507 leucine-rich repeat transmembrane protein kinase, putative Length = 935 Score = 32.7 bits (71), Expect = 0.29 Identities = 24/84 (28%), Positives = 36/84 (42%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+ + +K L L N + LG + +L L + N I L LK+LKH Sbjct: 70 PDPSDGFLHVKELLLSGNQLTGSLPQELGSLSNLLILQIDYNEISGKLPTSLANLKKLKH 129 Query: 454 LDLNNNIIESVDSIRFS*LPSLRH 525 +NNN I +S L ++ H Sbjct: 130 FHMNNNSITGQIPPEYSTLTNVLH 153 >At3g25560.1 68416.m03178 protein kinase family protein contains Prosite:PS00108: Serine/Threonine protein kinases active-site signature and PS00107: Protein kinases ATP-binding region signature Length = 635 Score = 32.7 bits (71), Expect = 0.29 Identities = 20/60 (33%), Positives = 33/60 (55%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L++L+ + L+NN I +G ++ L+ LDLS N L + K L++L +NNN Sbjct: 104 LTNLQTVLLQNNYITGNIPHEIGKLMKLKTLDLSTNNFTGQIPFTLSYSKNLQYLRVNNN 163 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 1/80 (1%) Frame = +1 Query: 235 KT*LLKHRLVTFE-PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQ 411 +T LL++ +T P L LK L L N+ L + +L+YL ++ N + Sbjct: 108 QTVLLQNNYITGNIPHEIGKLMKLKTLDLSTNNFTGQIPFTLSYSKNLQYLRVNNNSLTG 167 Query: 412 VSRHGLPFLKELKHLDLNNN 471 L + +L LDL+ N Sbjct: 168 TIPSSLANMTQLTFLDLSYN 187 >At3g25020.1 68416.m03127 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 890 Score = 32.7 bits (71), Expect = 0.29 Identities = 20/66 (30%), Positives = 35/66 (53%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L +L L+L NN+ +L + +E LDLS N + +GL L L + Sbjct: 717 PESLGLLKALIALNLSNNAFTGHIPLSLANLKKIESLDLSSNQLSGTIPNGLGTLSFLAY 776 Query: 454 LDLNNN 471 +++++N Sbjct: 777 MNVSHN 782 >At3g05370.1 68416.m00586 disease resistance family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2 disease resistance protein GB:AAC15780 from [Lycopersicon pimpinellifolium] Length = 860 Score = 32.7 bits (71), Expect = 0.29 Identities = 21/83 (25%), Positives = 37/83 (44%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P TF L+ L +++L NNS + ++ +L+Y ++ EN L + L+ Sbjct: 197 PVTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRW 256 Query: 454 LDLNNNIIESVDSIRFS*LPSLR 522 +L N+ + R PS R Sbjct: 257 ANLEGNMFKGPIEFRNMYSPSTR 279 Score = 30.7 bits (66), Expect = 1.2 Identities = 20/69 (28%), Positives = 34/69 (49%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L L+ L+L +N+ +L ++ LE LDLS N + GL L + Sbjct: 684 PESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIPQGLGSLSFMST 743 Query: 454 LDLNNNIIE 480 ++ + N +E Sbjct: 744 MNFSYNFLE 752 >At2g42290.1 68415.m05235 leucine-rich repeat family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 646 Score = 32.7 bits (71), Expect = 0.29 Identities = 20/66 (30%), Positives = 29/66 (43%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P L+SL L L +N+ L L Y+DLS N + + +K L H Sbjct: 84 PSELGLLNSLNRLDLAHNNFSKTIPVRLFEATKLRYIDLSHNSLSGPIPAQIKSMKSLNH 143 Query: 454 LDLNNN 471 LD ++N Sbjct: 144 LDFSSN 149 >At2g15320.1 68415.m01747 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611 Length = 382 Score = 32.7 bits (71), Expect = 0.29 Identities = 21/66 (31%), Positives = 33/66 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + L+SLK L LR+NS ++ + LE +D+S N + + L L+ Sbjct: 117 PSSISSLTSLKTLILRSNSFSGSLPDSVTRLNSLESIDISHNSLTGPLPKTMNSLSNLRQ 176 Query: 454 LDLNNN 471 LDL+ N Sbjct: 177 LDLSYN 182 >At2g15300.1 68415.m01745 leucine-rich repeat transmembrane protein kinase, putative Length = 744 Score = 32.7 bits (71), Expect = 0.29 Identities = 19/54 (35%), Positives = 26/54 (48%) Frame = +1 Query: 310 LSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L L N +L S +L ++HL LDLS+N + EL+ L L NN Sbjct: 81 LVLPNKQLLGSVSPDLFSILHLRILDLSDNFFHGSLPDSVSNASELRILSLGNN 134 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/66 (30%), Positives = 30/66 (45%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P++ S L+ILSL NN + ++ V L+ L+LS N + L K L Sbjct: 117 PDSVSNASELRILSLGNNKVSGELPRSISNVASLQLLNLSANALTGKIPPNLSLPKNLTV 176 Query: 454 LDLNNN 471 + L N Sbjct: 177 ISLAKN 182 >At1g71830.1 68414.m08301 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 625 Score = 32.7 bits (71), Expect = 0.29 Identities = 22/60 (36%), Positives = 31/60 (51%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L +L+ L L +N+I +NLG + +L LDL N L L +L+ L LNNN Sbjct: 92 LKNLQYLELYSNNITGPIPSNLGNLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLNNN 151 Score = 31.9 bits (69), Expect = 0.50 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 PE+ LS L+ L L NNS+ +L + L+ LDLS N Sbjct: 134 PESLGKLSKLRFLRLNNNSLTGSIPMSLTNITTLQVLDLSNN 175 >At1g61310.1 68414.m06910 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 925 Score = 32.7 bits (71), Expect = 0.29 Identities = 23/73 (31%), Positives = 36/73 (49%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L ++L E + L +L L +N + + ++ L+YLDLS I+Q+ Sbjct: 553 LQSNQLKNLSGEFIRYMQKLVVLDLSDNRDFNELPEQISGLVSLQYLDLSFTRIEQLP-V 611 Query: 424 GLPFLKELKHLDL 462 GL LK+L LDL Sbjct: 612 GLKELKKLTFLDL 624 >At1g17250.1 68414.m02101 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 756 Score = 32.7 bits (71), Expect = 0.29 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLI 405 L SL ++ L +N ++ LG HL Y+DLSENL+ Sbjct: 498 LKSLAVIDLSHNQLVGSIPGWLGTFPHLFYIDLSENLL 535 Score = 31.5 bits (68), Expect = 0.66 Identities = 20/51 (39%), Positives = 27/51 (52%) Frame = +1 Query: 319 RNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 RNN IP +G + L L+LS N + + H L L L+ LDL+NN Sbjct: 594 RNNLKGSIP-IEVGQLKVLHVLELSHNYLSGIIPHELSKLTSLERLDLSNN 643 >At5g65710.1 68418.m08270 leucine-rich repeat transmembrane protein kinase, putative Length = 993 Score = 32.3 bits (70), Expect = 0.38 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Frame = +1 Query: 247 LKHRLVTFE-PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLS 393 L+ L T E P+++ L++L++L+L N + I A LG++ L LDL+ Sbjct: 154 LESNLFTGEIPQSYGRLTALQVLNLNGNPLSGIVPAFLGYLTELTRLDLA 203 Score = 32.3 bits (70), Expect = 0.38 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 1/80 (1%) Frame = +1 Query: 292 LSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNN 468 L L+++ L NS L IPS + + +LE +++ EN++ + EL L+L+N Sbjct: 482 LRDLRVIDLSRNSFLGSIPSC-INKLKNLERVEMQENMLDGEIPSSVSSCTELTELNLSN 540 Query: 469 NIIESVDSIRFS*LPSLRHL 528 N + LP L +L Sbjct: 541 NRLRGGIPPELGDLPVLNYL 560 >At5g49660.1 68418.m06147 leucine-rich repeat transmembrane protein kinase, putative contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 966 Score = 32.3 bits (70), Expect = 0.38 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +1 Query: 253 HRLVTFEPETFEPLSSLKILSLRNNSILD-IPSANLGFVIHLEYLDLSENLIQQVSRHGL 429 +RLV P+ L + I+ L NS+ IP+A +G +L L + N I V H L Sbjct: 398 NRLVGTIPQGVMSLPHVSIIDLAYNSLSGPIPNA-IGNAWNLSELFMQSNRISGVIPHEL 456 Query: 430 PFLKELKHLDLNNN 471 L LDL+NN Sbjct: 457 SHSTNLVKLDLSNN 470 >At5g14210.1 68418.m01660 leucine-rich repeat transmembrane protein kinase, putative Length = 812 Score = 32.3 bits (70), Expect = 0.38 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 3/73 (4%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+T + L++L +LSL+NN +++ + L L LS N I LP L +L H Sbjct: 182 PDTLDSLTNLTVLSLKNNRFKGPFPSSICRIGRLTNLALSHNEIS----GKLPDLSKLSH 237 Query: 454 ---LDLNNNIIES 483 LDL N ++S Sbjct: 238 LHMLDLRENHLDS 250 Score = 27.9 bits (59), Expect = 8.1 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 1/95 (1%) Frame = +1 Query: 247 LKHRLVTFEPETFEPLSSLKILSLRNNSI-LDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L H ++ + LS L +L LR N + ++P + V L LS+N Sbjct: 220 LSHNEISGKLPDLSKLSHLHMLDLRENHLDSELPVMPIRLVTVL----LSKNSFSGEIPR 275 Query: 424 GLPFLKELKHLDLNNNIIESVDSIRFS*LPSLRHL 528 L +L+HLDL+ N + S LP++ +L Sbjct: 276 RFGGLSQLQHLDLSFNHLTGTPSRFLFSLPNISYL 310 >At4g08850.2 68417.m01455 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1009 Score = 32.3 bits (70), Expect = 0.38 Identities = 20/79 (25%), Positives = 37/79 (46%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L +R+ PE+ ++ + L L N + + + + +LEYLDLS N Sbjct: 509 LSSNRITGELPESISNINRISKLQLNGNRLSGKIPSGIRLLTNLEYLDLSSNRFSSEIPP 568 Query: 424 GLPFLKELKHLDLNNNIIE 480 L L L +++L+ N ++ Sbjct: 569 TLNNLPRLYYMNLSRNDLD 587 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 8 TQLTVLDISYNKILDLGSENFESNSEMRHLNLSNNFL 118 +QL +LD+SYN++ S F S + L+LS+N L Sbjct: 598 SQLQMLDLSYNQLDGEISSQFRSLQNLERLDLSHNNL 634 Score = 29.5 bits (63), Expect = 2.7 Identities = 21/84 (25%), Positives = 32/84 (38%) Frame = +2 Query: 2 LYTQLTVLDISYNKILDLGSENFESNSEMRHLNLSNNFLKRLDKDAFVGXXXXXXXXXXX 181 L T L LD+S N+ + + ++NLS N L + + Sbjct: 548 LLTNLEYLDLSSNRFSSEIPPTLNNLPRLYYMNLSRNDLDQTIPEGLTKLSQLQMLDLSY 607 Query: 182 XEISNIHVQTFRDLSALERLDFSN 253 ++ FR L LERLD S+ Sbjct: 608 NQLDGEISSQFRSLQNLERLDLSH 631 Score = 29.5 bits (63), Expect = 2.7 Identities = 24/95 (25%), Positives = 40/95 (42%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L +R + P T L L ++L N + L + L+ LDLS N + Sbjct: 557 LSSNRFSSEIPPTLNNLPRLYYMNLSRNDLDQTIPEGLTKLSQLQMLDLSYNQLDGEISS 616 Query: 424 GLPFLKELKHLDLNNNIIESVDSIRFS*LPSLRHL 528 L+ L+ LDL++N + F + +L H+ Sbjct: 617 QFRSLQNLERLDLSHNNLSGQIPPSFKDMLALTHV 651 >At4g08850.1 68417.m01454 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1045 Score = 32.3 bits (70), Expect = 0.38 Identities = 20/79 (25%), Positives = 37/79 (46%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L +R+ PE+ ++ + L L N + + + + +LEYLDLS N Sbjct: 509 LSSNRITGELPESISNINRISKLQLNGNRLSGKIPSGIRLLTNLEYLDLSSNRFSSEIPP 568 Query: 424 GLPFLKELKHLDLNNNIIE 480 L L L +++L+ N ++ Sbjct: 569 TLNNLPRLYYMNLSRNDLD 587 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 8 TQLTVLDISYNKILDLGSENFESNSEMRHLNLSNNFL 118 +QL +LD+SYN++ S F S + L+LS+N L Sbjct: 598 SQLQMLDLSYNQLDGEISSQFRSLQNLERLDLSHNNL 634 Score = 29.5 bits (63), Expect = 2.7 Identities = 21/84 (25%), Positives = 32/84 (38%) Frame = +2 Query: 2 LYTQLTVLDISYNKILDLGSENFESNSEMRHLNLSNNFLKRLDKDAFVGXXXXXXXXXXX 181 L T L LD+S N+ + + ++NLS N L + + Sbjct: 548 LLTNLEYLDLSSNRFSSEIPPTLNNLPRLYYMNLSRNDLDQTIPEGLTKLSQLQMLDLSY 607 Query: 182 XEISNIHVQTFRDLSALERLDFSN 253 ++ FR L LERLD S+ Sbjct: 608 NQLDGEISSQFRSLQNLERLDLSH 631 Score = 29.5 bits (63), Expect = 2.7 Identities = 24/95 (25%), Positives = 40/95 (42%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L +R + P T L L ++L N + L + L+ LDLS N + Sbjct: 557 LSSNRFSSEIPPTLNNLPRLYYMNLSRNDLDQTIPEGLTKLSQLQMLDLSYNQLDGEISS 616 Query: 424 GLPFLKELKHLDLNNNIIESVDSIRFS*LPSLRHL 528 L+ L+ LDL++N + F + +L H+ Sbjct: 617 QFRSLQNLERLDLSHNNLSGQIPPSFKDMLALTHV 651 >At3g53720.1 68416.m05934 cation/hydrogen exchanger, putative (CHX20) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 842 Score = 32.3 bits (70), Expect = 0.38 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 3/78 (3%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHL-EYLDLSENLI--QQVSRHGLPFLKE 444 P L SL + S+R IL + FV+HL E + S ++I Q+ ++GLPF+ Sbjct: 467 PANVSSLISL-VESIRTTKILRLKL----FVMHLMELTERSSSIIMVQRARKNGLPFVHR 521 Query: 445 LKHLDLNNNIIESVDSIR 498 +H + ++N+I ++ R Sbjct: 522 YRHGERHSNVIGGFEAYR 539 >At2g30100.1 68415.m03663 ubiquitin family protein low similarity to SP|Q9UQ13 Leucine-rich repeat protein SHOC-2 (Ras-binding protein Sur-8) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01535: PPR repeat, PF00560: Leucine Rich Repeat Length = 897 Score = 32.3 bits (70), Expect = 0.38 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +1 Query: 247 LKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDL 390 L +++ PETF L +LK L L N + +PSA + L L L Sbjct: 801 LSANIISELPETFTKLRNLKTLELNNTGLKTLPSALFKMCLQLSTLGL 848 >At2g26380.1 68415.m03166 disease resistance protein-related / LRR protein-related contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-2A [Lycopersicon pimpinellifolium] gi|3894389|gb|AAC78594 Length = 480 Score = 32.3 bits (70), Expect = 0.38 Identities = 21/85 (24%), Positives = 40/85 (47%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P L+ L L+++ N + +++ + L YL+L NL+ G+ LK + + Sbjct: 145 PANIGALNRLDTLTVKGNRFIGSIPSSISNLTRLNYLNLGGNLLTGTIPLGIANLKLISN 204 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 L+L+ N + F + +LR L Sbjct: 205 LNLDGNRLSGTIPDIFKSMTNLRIL 229 >At1g68780.1 68414.m07862 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to disease resistance protein [Lycopersicon esculentum] gi|3894383|gb|AAC78591 Length = 432 Score = 32.3 bits (70), Expect = 0.38 Identities = 23/66 (34%), Positives = 32/66 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE + L+ L IL + N + ++G + L LDLS N ++ L LK L Sbjct: 213 PEVYG-LTGLLILDVSRNFLSGALPLSVGGLYSLLKLDLSNNYLEGKLPRELESLKNLTL 271 Query: 454 LDLNNN 471 LDL NN Sbjct: 272 LDLRNN 277 >At1g65380.1 68414.m07417 receptor-like protein CLAVATA2 (CLV2) identical to receptor-like protein CLAVATA2 [Arabidopsis thaliana] gi|6049566|gb|AAF02654contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; Length = 720 Score = 32.3 bits (70), Expect = 0.38 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 1/92 (1%) Frame = +1 Query: 247 LKHRLVTFE-PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L H L+T + P L+ L+++ L +N++ N+ L L +S N + + Sbjct: 346 LSHNLLTGDIPARIGNLTYLQVIDLSHNALTGSIPLNIVGCFQLLALMISNNNLSGEIQP 405 Query: 424 GLPFLKELKHLDLNNNIIESVDSIRFS*LPSL 519 L L LK LD++NN I + + L SL Sbjct: 406 ELDALDSLKILDISNNHISGEIPLTLAGLKSL 437 Score = 32.3 bits (70), Expect = 0.38 Identities = 22/67 (32%), Positives = 31/67 (46%) Frame = +1 Query: 271 EPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 +PE + L SLKIL + NN I L + LE +D+S N + + LK Sbjct: 404 QPE-LDALDSLKILDISNNHISGEIPLTLAGLKSLEIVDISSNNLSGNLNEAITKWSNLK 462 Query: 451 HLDLNNN 471 +L L N Sbjct: 463 YLSLARN 469 >At5g61240.1 68418.m07681 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 380 Score = 31.9 bits (69), Expect = 0.50 Identities = 33/89 (37%), Positives = 47/89 (52%), Gaps = 4/89 (4%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN-LIQQVSRHGLPFLKELK 450 PE E L L L L NS L + L YL L EN LI ++ L L+ L+ Sbjct: 193 PEIGE-LKRLTHLYLSFNSFKGEIPKELAALPELRYLYLQENRLIGRIPAE-LGTLQNLR 250 Query: 451 HLDL-NNNIIESV-DSIRF-S*LPSLRHL 528 HLD+ NN+++ ++ + IRF P+LR+L Sbjct: 251 HLDVGNNHLVGTIRELIRFDGSFPALRNL 279 >At5g49290.1 68418.m06100 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 888 Score = 31.9 bits (69), Expect = 0.50 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Frame = +1 Query: 295 SSLKILSLRNNSILD-IPSANLGFVIHLEYLDLSENLIQ-QVSRHGLPFLKELKHLDLNN 468 +SL LSLR N++ IP L + +LE LDLS N I + GL L L+ L L Sbjct: 145 TSLTTLSLRRNNMYGPIPLKELKNLTNLELLDLSGNRIDGSMPVRGLKNLTNLEVLSLGY 204 Query: 469 NIIE 480 N + Sbjct: 205 NYFD 208 >At5g25910.1 68418.m03077 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596; Length = 811 Score = 31.9 bits (69), Expect = 0.50 Identities = 19/66 (28%), Positives = 33/66 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + L L +L+L NN +++G +I LE LD+S+N + L L L + Sbjct: 643 PRSVGLLKELHVLNLSNNGFTGHIPSSMGNLIELESLDVSQNKLSGEIPPELGKLSYLAY 702 Query: 454 LDLNNN 471 ++ + N Sbjct: 703 MNFSQN 708 Score = 29.5 bits (63), Expect = 2.7 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 5/81 (6%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNN---SILDIPSANLGFVIHLEYLDLSE-NLIQQVSRHGLPFLK 441 P LS L+ L L N + + +P+ G + L+Y+ L E NLI ++S + Sbjct: 177 PSEIGDLSELEELQLALNDKFTPVKLPT-EFGKLKKLKYMWLEEMNLIGEISAVVFENMT 235 Query: 442 ELKHLDLN-NNIIESVDSIRF 501 +LKH+DL+ NN+ + + F Sbjct: 236 DLKHVDLSVNNLTGRIPDVLF 256 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 P L LK L L N + A +GF+ LE ++SEN Sbjct: 323 PRAIGKLPELKELKLFTNKLTGEIPAEIGFISKLERFEVSEN 364 >At5g07280.1 68418.m00830 leucine-rich repeat protein kinase, putative / extra sporogenous cells (ESP) identical to extra sporogenous cells [Arabidopsis thaliana] gi|23304947|emb|CAD42912; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1192 Score = 31.9 bits (69), Expect = 0.50 Identities = 29/75 (38%), Positives = 38/75 (50%), Gaps = 1/75 (1%) Frame = +1 Query: 271 EPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 E T E L L I +N +IPS LG + LEYLD+SENL+ + L L+ Sbjct: 719 ELSTMEKLVGLYIE--QNKFTGEIPS-ELGNLTQLEYLDVSENLLSGEIPTKICGLPNLE 775 Query: 451 HLDL-NNNIIESVDS 492 L+L NN+ V S Sbjct: 776 FLNLAKNNLRGEVPS 790 Score = 31.1 bits (67), Expect = 0.87 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 1/86 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+ L +L+ L L N + + HL+ LDLS N + + L L +L + Sbjct: 82 PKEISSLKNLRELCLAGNQFSGKIPPEIWNLKHLQTLDLSGNSLTGLLPRLLSELPQLLY 141 Query: 454 LDLNNNIIE-SVDSIRFS*LPSLRHL 528 LDL++N S+ F LP+L L Sbjct: 142 LDLSDNHFSGSLPPSFFISLPALSSL 167 Score = 29.9 bits (64), Expect = 2.0 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 3/69 (4%) Frame = +1 Query: 295 SSLKI--LSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLN- 465 +SLK+ L+L NN + + G + L L+L++N + L LKEL H+DL+ Sbjct: 650 NSLKLQGLNLANNQLNGHIPESFGLLGSLVKLNLTKNKLDGPVPASLGNLKELTHMDLSF 709 Query: 466 NNIIESVDS 492 NN+ + S Sbjct: 710 NNLSGELSS 718 Score = 29.5 bits (63), Expect = 2.7 Identities = 21/66 (31%), Positives = 33/66 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+F L SL L+L N + A+LG + L ++DLS N + L +++L Sbjct: 669 PESFGLLGSLVKLNLTKNKLDGPVPASLGNLKELTHMDLSFNNLSGELSSELSTMEKLVG 728 Query: 454 LDLNNN 471 L + N Sbjct: 729 LYIEQN 734 >At3g47090.1 68416.m05113 leucine-rich repeat transmembrane protein kinase, putative receptor kinase-like protein (Xa21), Oryza longistaminata, U72725 Length = 1009 Score = 31.9 bits (69), Expect = 0.50 Identities = 18/58 (31%), Positives = 29/58 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKEL 447 P T +S+L++ + N + S N G + +L YL+L+ N + S L FL L Sbjct: 276 PTTLANISTLEMFGIGKNRMTGSISPNFGKLENLHYLELANNSLGSYSFGDLAFLDAL 333 Score = 28.7 bits (61), Expect = 4.6 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDL-NN 468 LS L L L NNS +G + L+YL + N ++ L L +LDL +N Sbjct: 89 LSFLIYLDLSNNSFGGTIPQEMGNLFRLKYLAVGFNYLEGEIPASLSNCSRLLYLDLFSN 148 Query: 469 NIIESVDS 492 N+ + V S Sbjct: 149 NLGDGVPS 156 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 23 LDISYNKILDLGSENFESNSEMRHLNLS-NNFLKRL 127 +D+S N + SE FE+ S++ +LNLS NNF R+ Sbjct: 558 VDLSNNNLSGSISEYFENFSKLEYLNLSDNNFEGRV 593 >At3g24900.1 68416.m03122 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 884 Score = 31.9 bits (69), Expect = 0.50 Identities = 19/66 (28%), Positives = 35/66 (53%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L +L L+L NN+ +L + +E LDLS N + +G+ L L + Sbjct: 719 PESIGLLKALIALNLSNNAFTGHIPLSLANLKKIESLDLSSNQLSGTIPNGIGTLSFLAY 778 Query: 454 LDLNNN 471 +++++N Sbjct: 779 MNVSHN 784 >At2g33080.1 68415.m04056 leucine-rich repeat family protein contains leucine rich-repeat domain Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 740 Score = 31.9 bits (69), Expect = 0.50 Identities = 20/66 (30%), Positives = 33/66 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P++ L L L+L NN+ +L LE LDLS N + +GL L L + Sbjct: 619 PKSIGLLKELIALNLSNNAFTCHIPLSLANATELESLDLSRNQLSGTIPNGLKTLSFLAY 678 Query: 454 LDLNNN 471 +++++N Sbjct: 679 INVSHN 684 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 11 QLTVLDISYNKILDLGSENFESNSEMRHLNLSNNFL 118 ++ VLD+S+N +F + S++ L+LSNN L Sbjct: 126 KVEVLDLSFNSFTGQVPSSFSNLSQLTELHLSNNQL 161 Score = 27.9 bits (59), Expect = 8.1 Identities = 21/65 (32%), Positives = 33/65 (50%) Frame = +1 Query: 277 ETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHL 456 + + PL+ K+L L I++ P+ L + LEY+D+S N I L L L+ + Sbjct: 287 DLYIPLTLEKLL-LEQCGIIEFPNI-LKTLQKLEYIDMSNNRINGKIPEWLWRLPRLRSM 344 Query: 457 DLNNN 471 L NN Sbjct: 345 SLANN 349 Score = 27.9 bits (59), Expect = 8.1 Identities = 23/79 (29%), Positives = 35/79 (44%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 LS+L + LR N++ L L+ LD+ NLI L L+ L ++NN Sbjct: 429 LSNLTFVHLRKNNLEGSIPDTLCAGDSLQTLDIGFNLISGTLPRSLLNCSSLEFLSVDNN 488 Query: 472 IIESVDSIRFS*LPSLRHL 528 I+ LP+L+ L Sbjct: 489 RIKDTFPFWLKALPNLQVL 507 >At2g31880.1 68415.m03895 leucine-rich repeat transmembrane protein kinase, putative Length = 641 Score = 31.9 bits (69), Expect = 0.50 Identities = 20/60 (33%), Positives = 30/60 (50%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 LS LK L+L NN +++ ++ LE LDL +N L L+ LDL++N Sbjct: 110 LSELKELTLSNNQLVNAVPVDILSCKQLEVLDLRKNRFSGQIPGNFSSLSRLRILDLSSN 169 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +2 Query: 11 QLTVLDISYNKILDLGSENFESNSEMRHLNLSNNFL 118 QL VLD+ N+ NF S S +R L+LS+N L Sbjct: 136 QLEVLDLRKNRFSGQIPGNFSSLSRLRILDLSSNKL 171 >At1g71390.1 68414.m08243 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-5B [Lycopersicon esculentum] gi|3894391|gb|AAC78595 Length = 784 Score = 31.9 bits (69), Expect = 0.50 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 1/93 (1%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSR 420 L +RLV P + L L+ LSL +N ++ +IPS +LG + L LDL N + Sbjct: 133 LSSNRLVGEIPYSIGNLKQLRNLSLGDNDLIGEIPS-SLGNLSLLLDLDLWNNSLVGEVP 191 Query: 421 HGLPFLKELKHLDLNNNIIESVDSIRFS*LPSL 519 + L EL+ + L+ N + I F+ L L Sbjct: 192 ASIGNLNELRVMSLDRNSLSGSIPISFTNLTKL 224 >At1g35710.1 68414.m04439 leucine-rich repeat transmembrane protein kinase, putative similar to many predicted protein kinases Length = 1120 Score = 31.9 bits (69), Expect = 0.50 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDL-SENLIQQVSRHGLPFLKELK 450 PE L++L L L N + A L F+ +LE LDL S N ++ + FLK L Sbjct: 599 PEAIGNLTNLSRLRLNGNQLSGRVPAGLSFLTNLESLDLSSNNFSSEIPQTFDSFLK-LH 657 Query: 451 HLDLNNN 471 ++L+ N Sbjct: 658 DMNLSRN 664 Score = 30.3 bits (65), Expect = 1.5 Identities = 24/74 (32%), Positives = 32/74 (43%) Frame = +1 Query: 265 TFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKE 444 TF+ F LS+L + L N + G + L Y DLS N + L LK Sbjct: 92 TFQDFPFISLSNLAYVDLSMNLLSGTIPPQFGNLSKLIYFDLSTNHLTGEISPSLGNLKN 151 Query: 445 LKHLDLNNNIIESV 486 L L L+ N + SV Sbjct: 152 LTVLYLHQNYLTSV 165 Score = 30.3 bits (65), Expect = 1.5 Identities = 23/85 (27%), Positives = 38/85 (44%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+TF+ L ++L N D L + L LDLS N + L L+ L Sbjct: 647 PQTFDSFLKLHDMNLSRNKF-DGSIPRLSKLTQLTQLDLSHNQLDGEIPSQLSSLQSLDK 705 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 LDL++N + + F + +L ++ Sbjct: 706 LDLSHNNLSGLIPTTFEGMIALTNV 730 Score = 29.1 bits (62), Expect = 3.5 Identities = 31/101 (30%), Positives = 45/101 (44%), Gaps = 4/101 (3%) Frame = +2 Query: 8 TQLTVLDISYNKILDLGSENFESNSEMRHLNLSNNFLKRLDKDAFVGXXXXXXXXXXXXE 187 TQLT LD+S+N++ S + L+LS+N L L F G + Sbjct: 677 TQLTQLDLSHNQLDGEIPSQLSSLQSLDKLDLSHNNLSGLIPTTFEGMIALTNVDISNNK 736 Query: 188 ISN--IHVQTFRDLSALERLDFSNIDWLLSN--RKHLSPCR 298 + TFR +A + L+ NI L SN ++ L PCR Sbjct: 737 LEGPLPDTPTFRKATA-DALE-ENIG-LCSNIPKQRLKPCR 774 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 2 LYTQLTVLDISYNKILDLGSENFESNSEMRHLNLSNN 112 +Y L +D S+NK S N+E + ++ L +SNN Sbjct: 532 IYPDLNFIDFSHNKFHGEISSNWEKSPKLGALIMSNN 568 >At1g11130.1 68414.m01274 leucine-rich repeat family protein / protein kinase family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to leucine-rich repeat transmembrane protein kinase 2 [Zea mays] gi|3360291|gb|AAC27895 Length = 768 Score = 31.9 bits (69), Expect = 0.50 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +1 Query: 295 SSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNI 474 SS++ LSL +N L F+ L L L NL+ L +L LDL++NI Sbjct: 115 SSIRNLSLSSNRFTGNIPFTLSFLSDLSELSLGSNLLSGEIPDYFQQLSKLTKLDLSSNI 174 Query: 475 IE 480 +E Sbjct: 175 LE 176 >At1g09970.2 68414.m01124 leucine-rich repeat transmembrane protein kinase, putative Similar to A. thaliana receptor-like protein kinase (gb|RLK5_ARATH). ESTs gb|ATTS0475,gb|ATTS4362 come from this gene isoform contains a TG acceptor site at intron. Length = 977 Score = 31.9 bits (69), Expect = 0.50 Identities = 23/65 (35%), Positives = 32/65 (49%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 + SL+ LSL NS+ I ++L L+YLDL NL L +L+ L LNN+ Sbjct: 96 IQSLEKLSLGFNSLSGIIPSDLKNCTSLKYLDLGNNLFSGAFPE-FSSLNQLQFLYLNNS 154 Query: 472 IIESV 486 V Sbjct: 155 AFSGV 159 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQ 408 P L++L L L NNS+ G + +L YLD S NL+Q Sbjct: 236 PSEISKLTNLWQLELYNNSLTGKLPTGFGNLKNLTYLDASTNLLQ 280 >At1g09970.1 68414.m01123 leucine-rich repeat transmembrane protein kinase, putative Similar to A. thaliana receptor-like protein kinase (gb|RLK5_ARATH). ESTs gb|ATTS0475,gb|ATTS4362 come from this gene isoform contains a TG acceptor site at intron. Length = 976 Score = 31.9 bits (69), Expect = 0.50 Identities = 23/65 (35%), Positives = 32/65 (49%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 + SL+ LSL NS+ I ++L L+YLDL NL L +L+ L LNN+ Sbjct: 96 IQSLEKLSLGFNSLSGIIPSDLKNCTSLKYLDLGNNLFSGAFPE-FSSLNQLQFLYLNNS 154 Query: 472 IIESV 486 V Sbjct: 155 AFSGV 159 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQ 408 P L++L L L NNS+ G + +L YLD S NL+Q Sbjct: 236 PSEISKLTNLWQLELYNNSLTGKLPTGFGNLKNLTYLDASTNLLQ 280 >At5g48740.1 68418.m06032 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 895 Score = 31.5 bits (68), Expect = 0.66 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPS--ANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLN 465 + SLK L N S + S + L +++LE LDL N +Q L LK+L+ L+L Sbjct: 426 VGSLKDLQKLNLSFNQLESFGSELEDLVNLEVLDLQNNSLQGSVPETLGKLKKLRLLNLE 485 Query: 466 NN 471 NN Sbjct: 486 NN 487 >At2g25790.1 68415.m03095 leucine-rich repeat transmembrane protein kinase, putative Length = 960 Score = 31.5 bits (68), Expect = 0.66 Identities = 20/60 (33%), Positives = 31/60 (51%) Frame = +1 Query: 298 SLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNII 477 SL+ L+L NN+ S GF+ +L LDLS N+ + + L+ LDL N++ Sbjct: 124 SLRYLNLSNNNFSG--SIPRGFLPNLYTLDLSNNMFTGEIYNDIGVFSNLRVLDLGGNVL 181 Score = 31.1 bits (67), Expect = 0.87 Identities = 23/63 (36%), Positives = 28/63 (44%) Frame = +1 Query: 283 FEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDL 462 F LK L L N I + L + LDLSEN I V L K L +LDL Sbjct: 474 FSRSKRLKKLDLSRNKISGVVPQGLMTFPEIMDLDLSENEITGVIPRELSSCKNLVNLDL 533 Query: 463 NNN 471 ++N Sbjct: 534 SHN 536 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +1 Query: 373 LEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNIIESV 486 L+ LDLS N I V GL E+ LDL+ N I V Sbjct: 480 LKKLDLSRNKISGVVPQGLMTFPEIMDLDLSENEITGV 517 Score = 27.9 bits (59), Expect = 8.1 Identities = 18/60 (30%), Positives = 30/60 (50%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 LS L+ L+L +N + LG + +L+++ L N + + + L L HLDL N Sbjct: 192 LSRLEFLTLASNQLTGGVPVELGKMKNLKWIYLGYNNLSGEIPYQIGGLSSLNHLDLVYN 251 Score = 27.9 bits (59), Expect = 8.1 Identities = 20/52 (38%), Positives = 24/52 (46%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 L + L PE L LK+L L +N ANLG +L LDLS N Sbjct: 320 LFSNNLTGKIPEGVTSLPRLKVLQLWSNRFSGGIPANLGKHNNLTVLDLSTN 371 >At2g25440.1 68415.m03047 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to NL0E [Lycopersicon esculentum] gi|4235643|gb|AAD13303 Length = 671 Score = 31.5 bits (68), Expect = 0.66 Identities = 19/66 (28%), Positives = 34/66 (51%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L +L L+L NN+ +L + L+ LD+S N + +GL L L + Sbjct: 506 PESIGLLKALIALNLSNNAFTGHIPQSLANLKELQSLDMSRNQLSGTIPNGLKQLSFLAY 565 Query: 454 LDLNNN 471 + +++N Sbjct: 566 ISVSHN 571 >At2g24130.1 68415.m02883 leucine-rich repeat transmembrane protein kinase, putative Length = 980 Score = 31.5 bits (68), Expect = 0.66 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 14 LTVLDISYNKILDLGSENFESNSEMRHLNLSNNFL 118 L LD+S+N++ +F+ +S ++HLN S N L Sbjct: 517 LKELDVSFNRLTGAIPPSFQQSSTLKHLNFSFNLL 551 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +2 Query: 509 CLHYVIWDLSDNNMT-LIPTSALSKLSNLSHLYLS 610 C++ I DLS NN+T IP +S L NL LYL+ Sbjct: 416 CINLEILDLSHNNLTGTIPVEVVSNLRNLK-LYLN 449 Score = 28.3 bits (60), Expect = 6.1 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIH-LEYLDLSENLIQQVSRHGLPFLKELKHLDLNN 468 L+ L +L L N + +G + L+ L LSENL+ L L L +LDL + Sbjct: 89 LTGLTVLDLSRNFFVGKIPPEIGSLHETLKQLSLSENLLHGNIPQELGLLNRLVYLDLGS 148 Query: 469 N 471 N Sbjct: 149 N 149 >At1g58190.1 68414.m06605 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 1784 Score = 31.5 bits (68), Expect = 0.66 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +1 Query: 295 SSLKILSLRNNSILD-IPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 SSL+ L L N++ P L + +LE LDLS NL+ GL L +L LDL++N Sbjct: 151 SSLRTLILHGNNMEGTFPMKELKDLSNLELLDLSGNLLNG-PVPGLAVLHKLHALDLSDN 209 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 P+ F L+ L++L + +N + + + LEYL LS+N Sbjct: 241 PQCFSSLTQLQVLDMSSNQFNGTLPSVISNLDSLEYLSLSDN 282 >At1g55610.1 68414.m06365 protein kinase family protein contains Prosite:PS00107: Protein kinases ATP-binding region signature Length = 1166 Score = 31.5 bits (68), Expect = 0.66 Identities = 21/68 (30%), Positives = 33/68 (48%) Frame = +1 Query: 268 FEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKEL 447 F P + + L++L+L +N I + G + + LDLS N +Q L L L Sbjct: 654 FIPPGYGNMGYLQVLNLGHNRITGTIPDSFGGLKAIGVLDLSHNNLQGYLPGSLGSLSFL 713 Query: 448 KHLDLNNN 471 LD++NN Sbjct: 714 SDLDVSNN 721 Score = 28.3 bits (60), Expect = 6.1 Identities = 20/52 (38%), Positives = 24/52 (46%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 L +RL P LS L IL L NNS+ LG L +LDL+ N Sbjct: 506 LSSNRLTGKIPSGIGNLSKLAILQLGNNSLSGNVPRQLGNCKSLIWLDLNSN 557 Score = 27.9 bits (59), Expect = 8.1 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 1/80 (1%) Frame = +1 Query: 235 KT*LLKHRLVTFE-PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQ 411 +T +L + L+T PE+ +++ +SL +N + + +G + L L L N + Sbjct: 478 ETLILNNNLLTGSIPESISRCTNMIWISLSSNRLTGKIPSGIGNLSKLAILQLGNNSLSG 537 Query: 412 VSRHGLPFLKELKHLDLNNN 471 L K L LDLN+N Sbjct: 538 NVPRQLGNCKSLIWLDLNSN 557 >At1g07650.1 68414.m00821 leucine-rich repeat transmembrane protein kinase, putative similar to GB:AAC50043 from [Arabidopsis thaliana] (Plant Mol. Biol. 37 (4), 587-596 (1998)) Length = 1014 Score = 31.5 bits (68), Expect = 0.66 Identities = 19/66 (28%), Positives = 30/66 (45%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+ L+ L+ LSL N ++G ++HLE L L N L LK L Sbjct: 154 PKVLTRLTMLRNLSLEGNQFSGPIPPDIGQLVHLEKLHLPSNAFTGPLTEKLGLLKNLTD 213 Query: 454 LDLNNN 471 + +++N Sbjct: 214 MRISDN 219 >At5g61480.1 68418.m07714 leucine-rich repeat transmembrane protein kinase, putative Length = 1041 Score = 31.1 bits (67), Expect = 0.87 Identities = 20/66 (30%), Positives = 31/66 (46%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE++ L SLK+L +N + + + +L +L L N + G+ L EL Sbjct: 290 PESYSNLKSLKLLDFSSNQLSGSIPSGFSTLKNLTWLSLISNNLSGEVPEGIGELPELTT 349 Query: 454 LDLNNN 471 L L NN Sbjct: 350 LFLWNN 355 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 14 LTVLDISYNKILDLGSENFESNSEMRHLNLSNNFLKR 124 LT +D+S N+ D +F + +++LNLS NF R Sbjct: 443 LTFVDLSNNRFTDQIPADFATAPVLQYLNLSTNFFHR 479 >At5g27060.1 68418.m03229 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 957 Score = 31.1 bits (67), Expect = 0.87 Identities = 19/66 (28%), Positives = 35/66 (53%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P++ L L +LSL NN+ +++G + LE LD+S+N + L L L + Sbjct: 783 PKSIGLLKELLVLSLSNNAFSGHMPSSMGNLTALESLDVSKNKLTGEIPQELGDLSFLAY 842 Query: 454 LDLNNN 471 ++ ++N Sbjct: 843 MNFSHN 848 >At4g19470.1 68417.m02864 disease resistance protein-related similar to disease resistance protein RPS4-Ler (GI:5823587)[Arabidopsis thaliana]; similar to TMV resistance protein N, Nicotiana glutinosa, PIR2:A54810; contains Pfam PF00560: Leucine Rich Repeat domains Length = 417 Score = 31.1 bits (67), Expect = 0.87 Identities = 32/89 (35%), Positives = 47/89 (52%), Gaps = 3/89 (3%) Frame = +1 Query: 229 FRKT*LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLE--YLDLSENL 402 FR L L F P+ F LSSL+ L L NSI ++P ++ + HL+ YL +NL Sbjct: 31 FRDMYLTDCNLYKF-PDNFSCLSSLQSLCLSRNSIENLP-GSIKKLHHLKSLYLKNCKNL 88 Query: 403 IQQVSRHGLPFLKELKHLDLNNNI-IESV 486 I LP L ++LD++ I +E+V Sbjct: 89 I------SLPVLPSNQYLDVHGCISLETV 111 >At3g43740.2 68416.m04673 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to somatic embryogenesis receptor-like kinase 2 [Arabidopsis thaliana] gi|14573457|gb|AAK68073 Length = 248 Score = 31.1 bits (67), Expect = 0.87 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 1/83 (1%) Frame = +1 Query: 226 CFRK-T*LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENL 402 CF + L K+ + P L SL L L NN++ ++LG + L +L L+EN Sbjct: 124 CFESYSELYKNEIQGTIPSELGNLKSLISLDLYNNNLTGKIPSSLGKLKSLVFLRLNENR 183 Query: 403 IQQVSRHGLPFLKELKHLDLNNN 471 + L + LK +D++ N Sbjct: 184 LTGPIPRELTVISSLKVVDVSGN 206 >At2g13790.1 68415.m01522 leucine-rich repeat family protein / protein kinase family protein Length = 620 Score = 31.1 bits (67), Expect = 0.87 Identities = 22/60 (36%), Positives = 30/60 (50%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L +L+ L L +N+I LG ++ L LDL N I L L +L+ L LNNN Sbjct: 98 LLNLQYLELYSNNITGEIPEELGDLVELVSLDLYANSISGPIPSSLGKLGKLRFLRLNNN 157 >At1g45616.1 68414.m05200 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to disease resistance protein [Lycopersicon esculentum] gi|3894383|gb|AAC78591 Length = 994 Score = 31.1 bits (67), Expect = 0.87 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 1/80 (1%) Frame = +1 Query: 292 LSSLKILSLRNNSI-LDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNN 468 +SSL +L+LRNNS+ +P+ + + L LD+S N ++ L L+ L++ + Sbjct: 639 MSSLSVLNLRNNSLDGSLPNIFMNAKV-LSSLDVSHNTLEGKLPASLAGCSALEILNVES 697 Query: 469 NIIESVDSIRFS*LPSLRHL 528 N I + LP L+ L Sbjct: 698 NNINDTFPFWLNSLPKLQVL 717 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/66 (28%), Positives = 36/66 (54%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L L +L+L +N+ ++L + +LE LD+S+N I L L L+ Sbjct: 821 PESVGILKELHVLNLSSNAFTGHIPSSLANLTNLESLDISQNKIGGEIPPELGTLSSLEW 880 Query: 454 LDLNNN 471 +++++N Sbjct: 881 INVSHN 886 >At5g23400.1 68418.m02739 disease resistance family protein / LRR family protein similar to disease resistance protein [Lycopersicon esculentum] gi|3894383|gb|AAC78591; contains leucine rich-repeat domain Pfam:PF00560, INTERPRO:IPR001611 Length = 589 Score = 30.7 bits (66), Expect = 1.2 Identities = 21/68 (30%), Positives = 37/68 (54%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+ E L+ LK+L++ +N I +++ ++ L LD+S N I + L +LK Sbjct: 462 PDFGESLN-LKVLNIGSNKISGQIPSSISNLVELVRLDISRNHITGGIPQAIGQLAQLKW 520 Query: 454 LDLNNNII 477 LDL+ N + Sbjct: 521 LDLSINAL 528 Score = 27.9 bits (59), Expect = 8.1 Identities = 22/81 (27%), Positives = 34/81 (41%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L +R P +F L L ++L NS ++ LE LDLS NL+ Sbjct: 163 LAGNRFSGLVPASFGSLRRLTTMNLARNSFSGPIPVTFKNLLKLENLDLSSNLLSGPIPD 222 Query: 424 GLPFLKELKHLDLNNNIIESV 486 + + L +L L++N V Sbjct: 223 FIGQFQNLTNLYLSSNRFSGV 243 >At4g33430.1 68417.m04750 brassinosteroid insensitive 1-associated receptor kinase 1 (BAK1) / somatic embryogenesis receptor-like kinase 3 (SERK3) identical to SP|Q94F62 BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor (EC 2.7.1.37) (BRI1-associated receptor kinase 1) (Somatic embryogenesis receptor-like kinase 3) {Arabidopsis thaliana}; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain; identical to cDNA somatic embryogenesis receptor-like kinase 3 (SERK3) GI:14573458 Length = 615 Score = 30.7 bits (66), Expect = 1.2 Identities = 22/60 (36%), Positives = 30/60 (50%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L +L+ L L +N+I LG + L LDL N + L LK+L+ L LNNN Sbjct: 91 LPNLQYLELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNN 150 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 P T L L+ L L NNS+ +L V+ L+ LDLS N Sbjct: 133 PSTLGRLKKLRFLRLNNNSLSGEIPRSLTAVLTLQVLDLSNN 174 Score = 27.9 bits (59), Expect = 8.1 Identities = 20/66 (30%), Positives = 31/66 (46%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE L+ L L L N++ + LG + L +L L+ N + L + L+ Sbjct: 109 PEQLGNLTELVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNNSLSGEIPRSLTAVLTLQV 168 Query: 454 LDLNNN 471 LDL+NN Sbjct: 169 LDLSNN 174 >At3g24954.1 68416.m03124 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 225 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/66 (28%), Positives = 34/66 (51%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L +L L+L NN+ + + +E LDLS N + +GL L L + Sbjct: 60 PESIGLLKALIALNLSNNAFTGHIPLSFANLKKMESLDLSSNQLSGTIPNGLRTLSFLAY 119 Query: 454 LDLNNN 471 +++++N Sbjct: 120 VNVSHN 125 >At2g33170.1 68415.m04064 leucine-rich repeat transmembrane protein kinase, putative similar to receptor protein kinase [Pinus sylvestris] gi|12054894|emb|CAC20842; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 1124 Score = 30.7 bits (66), Expect = 1.2 Identities = 22/65 (33%), Positives = 34/65 (52%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P F+ L+S++ L L +NS+ + LG L +D SEN Q+S PF+ + + Sbjct: 390 PPGFQNLTSMRQLQLFHNSLSGVIPQGLGLYSPLWVVDFSEN---QLSGKIPPFICQQSN 446 Query: 454 LDLNN 468 L L N Sbjct: 447 LILLN 451 >At2g33050.1 68415.m04053 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 800 Score = 30.7 bits (66), Expect = 1.2 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 1/80 (1%) Frame = +1 Query: 283 FEPLSSLKILSLRNNSILDIP-SANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLD 459 F PL SL + +R N +L S++ F + L L L + I + L+ L+H+D Sbjct: 257 FAPLKSLLVFDIRQNRLLPASLSSDSEFPLSLISLILIQCDIIEFPNI-FKTLQNLEHID 315 Query: 460 LNNNIIESVDSIRFS*LPSL 519 ++NN+I+ F LP L Sbjct: 316 ISNNLIKGKVPEWFWKLPRL 335 Score = 29.1 bits (62), Expect = 3.5 Identities = 21/66 (31%), Positives = 30/66 (45%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L L L+L NN+ +L V LE LDLS N + L L L + Sbjct: 609 PESIGLLKELIALNLSNNAFTGHIPMSLANVTELESLDLSRNQLSGNIPRELGSLSFLAY 668 Query: 454 LDLNNN 471 + + +N Sbjct: 669 ISVAHN 674 Score = 27.9 bits (59), Expect = 8.1 Identities = 22/79 (27%), Positives = 34/79 (43%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 LS+LK+++LR NS+ + LD+ N + L L+ L ++NN Sbjct: 423 LSNLKVVNLRKNSLEGSIPDEFHSGAKTQTLDVGYNRLTGKLPKSLLNCSSLRFLSVDNN 482 Query: 472 IIESVDSIRFS*LPSLRHL 528 IE LP+L L Sbjct: 483 RIEDTFPFWLKALPNLHVL 501 >At2g33020.1 68415.m04047 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611 Length = 864 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/66 (28%), Positives = 34/66 (51%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L +L L+L NN+ + +++LE LD+S N + +GL L L + Sbjct: 706 PESIGLLKALIALNLSNNAFTGHIPLSFANLMNLESLDMSGNQLSGTIPNGLGSLSFLVY 765 Query: 454 LDLNNN 471 + + +N Sbjct: 766 ISVAHN 771 >At2g01820.1 68415.m00113 leucine-rich repeat protein kinase, putative similar to protein kinase TMK1 gi|166888|gb|AAA32876; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 943 Score = 30.7 bits (66), Expect = 1.2 Identities = 21/66 (31%), Positives = 32/66 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + LS L IL L N I P +L + L+ L+L +NL V ++ + L+ Sbjct: 82 PTNLQSLSELVILELFLNRISG-PIPDLSGLSRLQTLNLHDNLFTSVPKNLFSGMSSLQE 140 Query: 454 LDLNNN 471 + L NN Sbjct: 141 MYLENN 146 >At1g53730.1 68414.m06114 leucine-rich repeat transmembrane protein kinase, putative similar to GI:3360289 from [Zea mays] (Plant Mol. Biol. 37 (5), 749-761 (1998)) Length = 719 Score = 30.7 bits (66), Expect = 1.2 Identities = 26/85 (30%), Positives = 37/85 (43%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P F P +L+ L+L NN S +L + L+YL+L N + L L Sbjct: 113 PYQFPP--NLQRLNLANNQFTGAASYSLSQITPLKYLNLGHNQFKGQIAIDFSKLDSLTT 170 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 LD + N + FS L SL+ L Sbjct: 171 LDFSFNSFTNSLPATFSSLTSLKSL 195 >At1g33670.1 68414.m04165 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to receptor kinase-like protein GB:AAB82755 GI:2586083 from [Oryza longistaminata] (Science 270 (5243), 1804-1806 (1995)) Length = 455 Score = 30.7 bits (66), Expect = 1.2 Identities = 23/85 (27%), Positives = 35/85 (41%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P L L+ + L NN + AN+G + +LE L ++ N + L L Sbjct: 121 PHFLFKLPKLRTVYLENNRLSGPLPANIGALSNLEILSVAGNRFSGSIPSSMSKLTSLLQ 180 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 L LN N + + F + LR L Sbjct: 181 LKLNGNRLSGIFPDIFKSMRQLRFL 205 >At5g63930.1 68418.m08028 leucine-rich repeat transmembrane protein kinase, putative Length = 1102 Score = 30.3 bits (65), Expect = 1.5 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 2/80 (2%) Frame = +1 Query: 295 SSLKILSLRNNSIL--DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNN 468 S ++LSL +S++ S ++G ++HL+ LDLS N + + L+ L LNN Sbjct: 71 SDPEVLSLNLSSMVLSGKLSPSIGGLVHLKQLDLSYNGLSGKIPKEIGNCSSLEILKLNN 130 Query: 469 NIIESVDSIRFS*LPSLRHL 528 N + + L SL +L Sbjct: 131 NQFDGEIPVEIGKLVSLENL 150 >At5g59650.1 68418.m07479 leucine-rich repeat protein kinase, putative contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 892 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/54 (33%), Positives = 30/54 (55%) Frame = +1 Query: 310 LSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L+L ++ + I +A + + HLE LDLS N + V L +K L ++L+ N Sbjct: 424 LNLSSSGLTGIIAAAIQNLTHLEKLDLSNNTLTGVVPEFLAQMKSLVIINLSGN 477 >At5g45840.1 68418.m05639 leucine-rich repeat transmembrane protein kinase, putative and genscan+ Length = 668 Score = 30.3 bits (65), Expect = 1.5 Identities = 28/86 (32%), Positives = 42/86 (48%), Gaps = 1/86 (1%) Frame = +1 Query: 265 TFEPETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLK 441 T PE + LS L+ L L N + DIP+ F LE+LDL +N + V L + Sbjct: 89 TLAPELSQ-LSELRSLILSKNKLSGDIPNEFASFA-KLEFLDLRDNNLNGVVPPELNKVL 146 Query: 442 ELKHLDLNNNIIESVDSIRFS*LPSL 519 ++L L+ N +++F L SL Sbjct: 147 TPENLLLSGNKFAGFMTVKFLRLQSL 172 >At4g28650.1 68417.m04095 leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase 5, Arabidopsis thaliana, PIR1:S27756 Length = 1013 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/52 (30%), Positives = 30/52 (57%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 L++++L P L+ L++L L NN++ ++LG L++LD+S N Sbjct: 315 LMRNKLSGSIPPAISSLAQLQVLELWNNTLSGELPSDLGKNSPLQWLDVSSN 366 Score = 27.9 bits (59), Expect = 8.1 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDL-SENLIQQVSRHGLPFLKELK 450 P+ F+ SL L L +N++ +++ L L+L + NL ++ R + + L Sbjct: 493 PDQFQDCPSLSNLDLSSNTLTGTIPSSIASCEKLVSLNLRNNNLTGEIPRQ-ITTMSALA 551 Query: 451 HLDLNNNIIESV 486 LDL+NN + V Sbjct: 552 VLDLSNNSLTGV 563 >At3g56370.1 68416.m06269 leucine-rich repeat transmembrane protein kinase, putative leucine-rich receptor-like protein kinase - Malus domestica, EMBL:AF053127 Length = 964 Score = 30.3 bits (65), Expect = 1.5 Identities = 22/76 (28%), Positives = 34/76 (44%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L K++L P + SSL L+L +N + + L LDLS N ++ Sbjct: 150 LAKNKLTGKIPVSISSCSSLAALNLSSNGFSGSMPLGIWSLNTLRSLDLSRNELEGEFPE 209 Query: 424 GLPFLKELKHLDLNNN 471 + L L+ LDL+ N Sbjct: 210 KIDRLNNLRALDLSRN 225 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/69 (27%), Positives = 33/69 (47%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE + L++L+ L L N + + +G + L+ +DLSEN + + L Sbjct: 208 PEKIDRLNNLRALDLSRNRLSGPIPSEIGSCMLLKTIDLSENSLSGSLPNTFQQLSLCYS 267 Query: 454 LDLNNNIIE 480 L+L N +E Sbjct: 268 LNLGKNALE 276 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/63 (30%), Positives = 30/63 (47%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L L+ L L NS+ + +G + HL LD+S N + + L+ L L NN Sbjct: 399 LRDLEGLHLSRNSLTGPIPSTIGELKHLSVLDVSHNQLNGMIPRETGGAVSLEELRLENN 458 Query: 472 IIE 480 ++E Sbjct: 459 LLE 461 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 2 LYTQLTVLDISYNKILDLGSENFESNSEMRHLNLSNN 112 L QLTV D+SYN ++ E + LN+++N Sbjct: 265 LLNQLTVFDVSYNNLVGSLPETIGDMKSLEQLNIAHN 301 >At3g11010.1 68416.m01329 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to disease resistance protein [Lycopersicon esculentum] gi|3894383|gb|AAC78591 Length = 894 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/66 (25%), Positives = 35/66 (53%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P++ L L +L+L NN+ +++G + LE LD+S+N + + L L + Sbjct: 720 PKSIGLLKELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSY 779 Query: 454 LDLNNN 471 ++ ++N Sbjct: 780 MNFSHN 785 >At3g03770.1 68416.m00383 leucine-rich repeat transmembrane protein kinase, putative may contain C-terminal ser/thr protein kinase domain, similar to serine/threonine protein kinase Pto GB:AAB47421 [Lycopersicon esculentum] Length = 802 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +2 Query: 14 LTVLDISYNKILDLGSENFESNSEMRHLNLSNNFL 118 +T L+IS+NK+ S N NS++ +++S+N L Sbjct: 296 ITYLNISHNKLTGRLSANLSCNSQLMFVDMSSNLL 330 Score = 29.9 bits (64), Expect = 2.0 Identities = 24/85 (28%), Positives = 36/85 (42%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+ LSSL+IL++ +N + L + L+ L L EN+ + L L Sbjct: 122 PQKINRLSSLEILNVSSNFLFGPIPHELSSLATLQTLILDENMFSGELPDWIDSLPSLAV 181 Query: 454 LDLNNNIIESVDSIRFS*LPSLRHL 528 L L N++ S L LR L Sbjct: 182 LSLRKNVLNGSLPSSLSSLSGLRVL 206 >At2g32680.1 68415.m03995 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 890 Score = 30.3 bits (65), Expect = 1.5 Identities = 28/87 (32%), Positives = 39/87 (44%), Gaps = 2/87 (2%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 P + L L L+LR N++ + +N LE + L N + + L LK Sbjct: 284 PSSLLTLPFLAHLALRENNLAGSVEVSNSSTSSRLEIMYLGSNHFEGQILEPISKLINLK 343 Query: 451 HLDLN-NNIIESVDSIRFS*LPSLRHL 528 HLDL+ N +D FS L SLR L Sbjct: 344 HLDLSFLNTSYPIDLKLFSSLKSLRSL 370 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +1 Query: 283 FEPLSSLKILSLRNNSILDIPSANLGFV-IHLEYLDLSENLIQQVSRHGLPFLKELKHLD 459 F L SL+ L L NSI ++ ++ + LE L L I + L LKEL ++D Sbjct: 361 FSSLKSLRSLDLSGNSISSASLSSDSYIPLTLEMLTLRHCDINEFPNI-LKTLKELVYID 419 Query: 460 LNNN 471 ++NN Sbjct: 420 ISNN 423 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/66 (24%), Positives = 36/66 (54%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L +L +++ NN+ ++ + +LE LD+S N + +GL + L + Sbjct: 717 PESIGLLKALIAVNISNNAFTGHIPLSMANLENLESLDMSRNQLSGTIPNGLGSISFLAY 776 Query: 454 LDLNNN 471 +++++N Sbjct: 777 INVSHN 782 >At2g20850.1 68415.m02457 leucine-rich repeat protein kinase, putative contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 772 Score = 30.3 bits (65), Expect = 1.5 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 3/69 (4%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPSA--NLGFVIHLEYLDLSENLIQQVSRHGLPFLKE 444 PE+ L SL ++SL NN + IP +LG +I+ +DLS N + + L Sbjct: 136 PESLSSLKSLSVMSLNNNLLSGKIPDVFQDLGLMIN---IDLSSNNLSGPLPPSMQNLST 192 Query: 445 LKHLDLNNN 471 L L L NN Sbjct: 193 LTSLLLQNN 201 >At1g62630.1 68414.m07066 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 893 Score = 30.3 bits (65), Expect = 1.5 Identities = 24/98 (24%), Positives = 44/98 (44%), Gaps = 1/98 (1%) Frame = +2 Query: 11 QLTVLDISYNKILDLGSENFESNSEMRHLNLSNNFLKRLDKDAFVGXXXXXXXXXXXXEI 190 +L VLD+S+N+ L E + +++LNLS+ ++ L K ++ Sbjct: 571 KLAVLDLSHNQSLFELPEEISNLVSLKYLNLSHTGIRHLSKGIQELKKIIHLNLEHTSKL 630 Query: 191 SNIH-VQTFRDLSALERLDFSNIDWLLSNRKHLSPCRH 301 +I + + +L L +L S + W L+ K L H Sbjct: 631 ESIDGISSLHNLKVL-KLYGSRLPWDLNTVKELETLEH 667 >At1g47890.1 68414.m05333 disease resistance family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 1019 Score = 30.3 bits (65), Expect = 1.5 Identities = 22/59 (37%), Positives = 33/59 (55%) Frame = +1 Query: 295 SSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 S+L+ LSLR+ +I D P + +L+ LDLS N I+ L + L +DL+NN Sbjct: 518 SNLEYLSLRSCNITDFPEF-IRKGRNLQILDLSNNKIKGQVPDWLWRMPTLNSVDLSNN 575 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/66 (27%), Positives = 35/66 (53%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P++ L L+IL++ +N ++L + +LE LD+S+N I L L L Sbjct: 848 PDSIGLLKELRILNMSSNGFTGHIPSSLANLKNLESLDISQNNISGEIPPELGTLSSLAW 907 Query: 454 LDLNNN 471 +++++N Sbjct: 908 INVSHN 913 Score = 28.7 bits (61), Expect = 4.6 Identities = 25/70 (35%), Positives = 32/70 (45%), Gaps = 2/70 (2%) Frame = +1 Query: 268 FEPETFEPLSSLKILSLRNNSILD-IPSANLGFVIHLEYLDLSENLIQQVSRHGL-PFLK 441 F+ F P SL+ S NN+ IP + G + LE LDLS N + L + Sbjct: 602 FQGPLFLPSKSLRYFSGSNNNFTGKIPRSICG-LSSLEILDLSNNNLNGSLPWCLETLMS 660 Query: 442 ELKHLDLNNN 471 L LDL NN Sbjct: 661 SLSDLDLRNN 670 >At1g33610.1 68414.m04160 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611 Length = 907 Score = 30.3 bits (65), Expect = 1.5 Identities = 25/93 (26%), Positives = 40/93 (43%), Gaps = 1/93 (1%) Frame = +1 Query: 253 HRLVTFEPETFEPLSSLKILSLRNNSILD-IPSANLGFVIHLEYLDLSENLIQQVSRHGL 429 +RL P F+ + L L L N +P + L YLDLS+N + + L Sbjct: 637 NRLSGTIPNIFKSMKELNSLDLSRNGFFGRLPPSIASLAPTLYYLDLSQNNLSGTIPNYL 696 Query: 430 PFLKELKHLDLNNNIIESVDSIRFS*LPSLRHL 528 + L L L+ N V + F+ L ++ +L Sbjct: 697 SRFEALSTLVLSKNKYSGVVPMSFTNLINITNL 729 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/66 (27%), Positives = 29/66 (43%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P LS LK L + N +++ + L +L+L N + + +KEL Sbjct: 596 PANIGELSQLKTLVIDGNMFTGHIPSSIANLTRLTWLNLGNNRLSGTIPNIFKSMKELNS 655 Query: 454 LDLNNN 471 LDL+ N Sbjct: 656 LDLSRN 661 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 373 LEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNII 477 LE LDLS+N V G L + +LDL++N++ Sbjct: 274 LEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLL 308 >At1g09760.1 68414.m01095 U2 small nuclear ribonucleoprotein A, putative identical to U2 small nuclear ribonucleoprotein A' (U2 snRNP-A') [Arabidopsis thaliana] SWISS-PROT:P43333; supported by cDNA:gi_16649064_gb_AY059902.1_ Length = 249 Score = 30.3 bits (65), Expect = 1.5 Identities = 30/91 (32%), Positives = 40/91 (43%), Gaps = 1/91 (1%) Frame = +1 Query: 259 LVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVI-HLEYLDLSENLIQQVSRHGLPF 435 L+ P F + + L LR N I I NLG + +DLS+N I V P+ Sbjct: 8 LIWKSPHFFNAIKERE-LDLRGNKIPVIE--NLGATEDQFDTIDLSDNEI--VKLENFPY 62 Query: 436 LKELKHLDLNNNIIESVDSIRFS*LPSLRHL 528 L L L +NNN I ++ LP L L Sbjct: 63 LNRLGTLLINNNRITRINPNLGEFLPKLHSL 93 >At4g39400.1 68417.m05577 brassinosteroid insensitive 1 (BRI1) identical to GI:2392895 Length = 1196 Score = 29.9 bits (64), Expect = 2.0 Identities = 21/53 (39%), Positives = 26/53 (49%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENL 402 L +RL P+ L +L IL L NNS A LG L +LDL+ NL Sbjct: 519 LSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNL 571 Score = 28.7 bits (61), Expect = 4.6 Identities = 20/66 (30%), Positives = 30/66 (45%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+ + L IL+L +N I +G + L LDLS N + + L L Sbjct: 671 PKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTE 730 Query: 454 LDLNNN 471 +DL+NN Sbjct: 731 IDLSNN 736 >At4g13820.1 68417.m02141 disease resistance family protein / LRR family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to disease resistance protein [Lycopersicon esculentum] gi|3894383|gb|AAC78591 Length = 719 Score = 29.9 bits (64), Expect = 2.0 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 2/85 (2%) Frame = +1 Query: 274 PETFEPLSS-LKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKEL 447 P FE ++ L +L LRNN++ + P ++ HL LD+ N + L L Sbjct: 509 PRCFEKFNTTLSVLHLRNNNLSGEFPEESISD--HLRSLDVGRNRLSGELPKSLINCTRL 566 Query: 448 KHLDLNNNIIESVDSIRFS*LPSLR 522 + L++ +NII LP L+ Sbjct: 567 EFLNVEDNIINDKFPFWLRMLPKLQ 591 >At3g14460.1 68416.m01832 disease resistance protein (NBS-LRR class), putative domain signature NBS-LRR exists, suggestive of a disease resistance protein. Length = 1424 Score = 29.9 bits (64), Expect = 2.0 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 2/80 (2%) Frame = +1 Query: 223 ICFRKT*LLKH-RLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLD-LSE 396 +C +T LL + R +T P++ L +L++L L ++++P + L L LS Sbjct: 618 LCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTPLVEMPPG----IKKLRSLQKLSN 673 Query: 397 NLIQQVSRHGLPFLKELKHL 456 +I ++S GL LKEL HL Sbjct: 674 FVIGRLSGAGLHELKELSHL 693 >At2g34680.1 68415.m04260 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560; identical to cDNA hypothetical protein (AIR9) mRNA, partial cds GI:3695020 Length = 1661 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/54 (33%), Positives = 29/54 (53%) Frame = +1 Query: 310 LSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L LR + I + S L +LE++ L +NL+ + G+ L +K LDL+ N Sbjct: 273 LDLRGHRIRSLTSGGLHLSPNLEFVYLRDNLLSTL--EGIEILNRVKVLDLSFN 324 >At1g61190.1 68414.m06895 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 967 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/73 (30%), Positives = 36/73 (49%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 L ++L E + L +L L +N + + ++ L+YLDLS I+Q+ Sbjct: 544 LQSNQLKNLSGEFIRYMQKLVVLDLSHNPDFNELPEQISGLVSLQYLDLSWTRIEQLP-V 602 Query: 424 GLPFLKELKHLDL 462 GL LK+L L+L Sbjct: 603 GLKELKKLIFLNL 615 >At5g49770.1 68418.m06164 leucine-rich repeat transmembrane protein kinase, putative Length = 946 Score = 29.5 bits (63), Expect = 2.7 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 1/67 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELK 450 PE+ + +L +L L N + DIPS+ L + +L+ L LS+N S L L L Sbjct: 238 PESLGLVQNLTVLRLDRNRLSGDIPSS-LNNLTNLQELHLSDNKFTG-SLPNLTSLTSLY 295 Query: 451 HLDLNNN 471 LD++NN Sbjct: 296 TLDVSNN 302 >At4g28560.1 68417.m04085 leucine-rich repeat family protein (fragment) contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; Length = 450 Score = 29.5 bits (63), Expect = 2.7 Identities = 21/60 (35%), Positives = 30/60 (50%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L +LK+L +N I ++G + L LDLS N G+ LK+L LDL+ N Sbjct: 225 LKNLKVLDFSHNFINGNAPDSIGDLTELLKLDLSFNEFTGEVPSGVGNLKKLVFLDLSYN 284 >At4g28380.1 68417.m04062 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979 Length = 391 Score = 29.5 bits (63), Expect = 2.7 Identities = 23/71 (32%), Positives = 30/71 (42%) Frame = +1 Query: 268 FEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKEL 447 F PE LS L ++ L +N I + + L LDLS N + L L Sbjct: 105 FLPEAIGLLSDLALIHLNSNRFCGILPRSFANLSLLYELDLSNNRFVGPFPDVVLALPSL 164 Query: 448 KHLDLNNNIIE 480 K+LDL N E Sbjct: 165 KYLDLRYNEFE 175 >At4g16940.1 68417.m02555 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1103 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +1 Query: 286 EPLSSLKILSLRN-NSILDIPSANLGFVIHLEYLDL 390 +PL SLK ++LRN N++ +IP +L +LE LDL Sbjct: 622 QPLGSLKKMNLRNSNNLKEIP--DLSLATNLEELDL 655 >At4g13920.1 68417.m02154 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 891 Score = 29.5 bits (63), Expect = 2.7 Identities = 19/69 (27%), Positives = 35/69 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L L +L++ NN+ +L + +L+ LDLS+N + L L L Sbjct: 730 PESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLAR 789 Query: 454 LDLNNNIIE 480 ++ + N++E Sbjct: 790 MNFSYNMLE 798 >At3g08680.2 68416.m01009 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profile: PF00069 Eukaryotic protein kinase domain, PF00560 leucine Rich Repeat (5 copies) Length = 640 Score = 29.5 bits (63), Expect = 2.7 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 4/77 (5%) Frame = +1 Query: 277 ETFEPLSSLKILSLRNNSIL-DIPSA--NLGFVIHLEYLDLS-ENLIQQVSRHGLPFLKE 444 +TFE L +L+I+SLR+N + +IPS +L F+ L + + + I V H L L + Sbjct: 86 KTFEKLDALRIISLRSNHLQGNIPSVILSLPFIRSLYFHENNFSGTIPPVLSHRLVNL-D 144 Query: 445 LKHLDLNNNIIESVDSI 495 L L+ NI S+ ++ Sbjct: 145 LSANSLSGNIPTSLQNL 161 >At3g08680.1 68416.m01008 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profile: PF00069 Eukaryotic protein kinase domain, PF00560 leucine Rich Repeat (5 copies) Length = 640 Score = 29.5 bits (63), Expect = 2.7 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 4/77 (5%) Frame = +1 Query: 277 ETFEPLSSLKILSLRNNSIL-DIPSA--NLGFVIHLEYLDLS-ENLIQQVSRHGLPFLKE 444 +TFE L +L+I+SLR+N + +IPS +L F+ L + + + I V H L L + Sbjct: 86 KTFEKLDALRIISLRSNHLQGNIPSVILSLPFIRSLYFHENNFSGTIPPVLSHRLVNL-D 144 Query: 445 LKHLDLNNNIIESVDSI 495 L L+ NI S+ ++ Sbjct: 145 LSANSLSGNIPTSLQNL 161 >At2g28970.1 68415.m03524 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 786 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 P F+ L+ ++ L L NNS+ + + L + L LDLS N Sbjct: 325 PSVFQNLTQIQELDLSNNSLTGLVPSFLANIKSLSLLDLSGN 366 >At2g02060.1 68415.m00141 calcium-dependent protein kinase-related / CDPK-related contains TIGRFAM TIGR01557: myb-like DNA-binding domain, SHAQKYF class; contains Pfam PF00249: Myb-like DNA-binding domain; similar to CDPK substrate protein 1; CSP1 (GI:6942190) [Mesembryanthemum crystallinum]. Length = 626 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = -1 Query: 152 SIRRRRLYQDALRNYYLNSNVSFHC---CFRSFHYLNLIS 42 SIRRR QD+ +YYL+ N+S H C FH L S Sbjct: 99 SIRRR---QDSEEDYYLHDNLSLHTRNDCLLGFHSFPLSS 135 >At1g74190.1 68414.m08592 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.1 [Lycopersicon pimpinellifolium] gi|1184075|gb|AAC15779 Length = 965 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +1 Query: 298 SLKILSLRNNSILDIPSANLGFVI-HLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 +L L + N + N+G++ HL YL+ S+N Q+ L + ++++DL+ N Sbjct: 414 NLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQENLPSSLGNMNGIQYMDLSRN 472 >At1g33590.1 68414.m04158 disease resistance protein-related / LRR protein-related contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596 Length = 477 Score = 29.5 bits (63), Expect = 2.7 Identities = 19/68 (27%), Positives = 29/68 (42%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+ L +LK + + NN + AN+G + LE L N + L L Sbjct: 119 PQFLFQLPNLKYVYIENNRLSGTLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTLLTQ 178 Query: 454 LDLNNNII 477 L L NN++ Sbjct: 179 LKLGNNLL 186 >At1g27170.1 68414.m03310 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1544 Score = 29.5 bits (63), Expect = 2.7 Identities = 21/63 (33%), Positives = 34/63 (53%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L +L+ILSLR I ++P +G + LE L L + ++ + + LK L+ Sbjct: 941 PESINRLQNLEILSLRGCKIQELPLC-IGTLKSLEKLYLDDTALKNLP-SSIGDLKNLQD 998 Query: 454 LDL 462 L L Sbjct: 999 LHL 1001 >At1g17750.1 68414.m02197 leucine-rich repeat transmembrane protein kinase, putative similar to receptor-like protein kinase INRPK1 GI:1684913 from [Ipomoea nil] Length = 1088 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 L SL L L NS + + LG LEYLDLS N Sbjct: 99 LKSLVTLDLSLNSFSGLLPSTLGNCTSLEYLDLSNN 134 Score = 27.9 bits (59), Expect = 8.1 Identities = 23/69 (33%), Positives = 37/69 (53%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE E LS L ++L +NS +LG +L +DLS+N + + L L+ L Sbjct: 477 PEFPESLS-LSYVNLGSNSFEGSIPRSLGSCKNLLTIDLSQNKLTGLIPPELGNLQSLGL 535 Query: 454 LDLNNNIIE 480 L+L++N +E Sbjct: 536 LNLSHNYLE 544 >At4g23740.1 68417.m03415 leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase - Arabidopsis thaliana RKL1, PID:g4008006 Length = 638 Score = 29.1 bits (62), Expect = 3.5 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P T LS+L++LSLR+N I + + L +L L +N + K L Sbjct: 86 PNTISRLSALRVLSLRSNLISGEFPKDFVELKDLAFLYLQDNNLSGPLPLDFSVWKNLTS 145 Query: 454 LDLNNN 471 ++L+NN Sbjct: 146 VNLSNN 151 Score = 28.3 bits (60), Expect = 6.1 Identities = 18/66 (27%), Positives = 32/66 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P F +L ++L NN ++L + ++ L+L+ N + L L L+H Sbjct: 134 PLDFSVWKNLTSVNLSNNGFNGTIPSSLSRLKRIQSLNLANNTLSG-DIPDLSVLSSLQH 192 Query: 454 LDLNNN 471 +DL+NN Sbjct: 193 IDLSNN 198 >At4g13810.1 68417.m02140 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to disease resistance protein [Lycopersicon esculentum] gi|3894383|gb|AAC78591 Length = 741 Score = 29.1 bits (62), Expect = 3.5 Identities = 19/69 (27%), Positives = 36/69 (52%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L + +LS+ NN+ +L + +L+ LDLS+N + L L L+ Sbjct: 580 PESIGLLKEVIVLSMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGKLTFLEW 639 Query: 454 LDLNNNIIE 480 ++ ++N +E Sbjct: 640 MNFSHNRLE 648 Score = 28.3 bits (60), Expect = 6.1 Identities = 19/59 (32%), Positives = 33/59 (55%) Frame = +1 Query: 295 SSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 S ++ L L + +I + P L LEYLD+S N I+ L L EL+++++++N Sbjct: 253 SPIEYLGLLSCNISEFPKF-LRNQTSLEYLDISANQIEGQVPEWLWSLPELRYVNISHN 310 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 P++ L LK+L L N ++ ++LG + +L +LDLS N Sbjct: 67 PDSIGNLKRLKVLVLVNCNLFGKIPSSLGNLSYLTHLDLSYN 108 >At3g49750.1 68416.m05439 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to resistance gene Hcr2-5B, Lycopersicon esculentum, EMBL:AF053997 Length = 274 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/66 (25%), Positives = 30/66 (45%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + L +L +L+L +N + + L +L +DL +N + L L L Sbjct: 114 PPEIQYLVNLAVLNLSSNHLSGEITPQLALCAYLNVIDLHDNELSGQIPQQLGLLARLSA 173 Query: 454 LDLNNN 471 D++NN Sbjct: 174 FDVSNN 179 Score = 27.9 bits (59), Expect = 8.1 Identities = 20/54 (37%), Positives = 28/54 (51%) Frame = +1 Query: 310 LSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 LSL N S+ S L +L+ LDLS N I V + +L L L+L++N Sbjct: 78 LSLTNLSLRGSISPFLSNCTNLQSLDLSSNQISGVIPPEIQYLVNLAVLNLSSN 131 >At3g43190.1 68416.m04558 sucrose synthase, putative / sucrose-UDP glucosyltransferase, putative strong similarity to SP|P49040 Sucrose synthase (EC 2.4.1.13) (Sucrose-UDP glucosyltransferase) {Arabidopsis thaliana} (SUS1) Length = 808 Score = 29.1 bits (62), Expect = 3.5 Identities = 20/65 (30%), Positives = 30/65 (46%) Frame = -1 Query: 491 ESTLSIILLFKSKCFNSFKNGKPCLETCCIKFSDRSKYSR*MTNPRLADGISNMELFLSD 312 E S L FK + + KNG LE F+ + + R N + DG+ + LS Sbjct: 111 ELQASEYLQFKEELVDGIKNGNFTLELDFEPFN--AAFPRPTLNKYIGDGVEFLNRHLSA 168 Query: 311 KIFND 297 K+F+D Sbjct: 169 KLFHD 173 >At3g23110.1 68416.m02913 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 835 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 8 TQLTVLDISYNKILDLGSENFESNSEMRHLNLSNN 112 ++LT LD+SYN + L ++ + + HL LS+N Sbjct: 280 SKLTELDVSYNNLDGLIPKSISTLVSLEHLELSHN 314 >At3g11080.1 68416.m01339 disease resistance family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 943 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/66 (27%), Positives = 35/66 (53%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P++ L L +L+L NN+ +++G + LE LD+S+N + L L L + Sbjct: 771 PKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTGEIPQELGDLSFLAY 830 Query: 454 LDLNNN 471 ++ ++N Sbjct: 831 MNFSHN 836 Score = 27.9 bits (59), Expect = 8.1 Identities = 23/68 (33%), Positives = 32/68 (47%) Frame = +1 Query: 289 PLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNN 468 P S++ L L I D P L L +LD+S N I+ L L L +L+L+N Sbjct: 466 PSQSIQSLYLSGCGITDFPEI-LRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSN 524 Query: 469 NIIESVDS 492 N S +S Sbjct: 525 NTFISFES 532 >At1g80080.1 68414.m09374 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; contains some similarity to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596 Length = 496 Score = 29.1 bits (62), Expect = 3.5 Identities = 20/59 (33%), Positives = 28/59 (47%) Frame = +1 Query: 295 SSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 SSL+ L LR N L LG + +L+ LDL +N + L+ LDL+ N Sbjct: 159 SSLQTLVLRENGFLGPIPDELGNLTNLKVLDLHKNHLNGSIPLSFNRFSGLRSLDLSGN 217 >At1g74200.1 68414.m08594 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to disease resistance protein [Lycopersicon esculentum] gi|3894383|gb|AAC78591 disease resistance protein [Lycopersicon esculentum] gi|3894383|gb|AAC78591 Length = 302 Score = 29.1 bits (62), Expect = 3.5 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 2/96 (2%) Frame = +1 Query: 247 LKHRLVTFE--PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSR 420 L H+ ++ E PE S L+ LS+ NN L + L LD+S N + V Sbjct: 52 LSHKKLSEEVFPEASNFFSILE-LSMDNNLFTGKIGRGLQSLRSLIMLDISNNNLSGVIP 110 Query: 421 HGLPFLKELKHLDLNNNIIESVDSIRFS*LPSLRHL 528 L++L L ++NN++E I + SL+ L Sbjct: 111 SWFDQLQDLHSLQISNNLLEGEVPISLFNMSSLQLL 146 >At1g65540.1 68414.m07435 calcium-binding EF hand family protein similar to leucine zipper-EF-hand containing transmembrane protein 1 [Homo sapiens] GI:4235226; contains Pfam profile PF00036: EF hand Length = 736 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -1 Query: 368 MTNPRLADGISNMELFLSDKIFNDDKG-SNVSGSKVTSLC 252 MT R G+SN E+ K+FND+ N++ S++ ++C Sbjct: 324 MTKVRRGVGVSNDEILGFAKLFNDELTLDNINRSRLVNMC 363 >At1g61300.1 68414.m06909 disease resistance protein (NBS-LRR class), putative domain signature NBS-LRR exists, suggestive of a disease resistance protein. Length = 762 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 11 QLTVLDISYNKILDLGSENFESNSEMRHLNLSNNFLKRL 127 +L VLD+SYN+ + E ++ L+LSN +K+L Sbjct: 447 KLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIKQL 485 >At1g34210.1 68414.m04245 somatic embryogenesis receptor-like kinase 2 (SERK2) nearly identical to somatic embryogenesis receptor-like kinase 2 [Arabidopsis thaliana] GI:14573457; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain; identical to cDNA somatic embryogenesis receptor-like kinase 2 (SERK2) GI:14573456 Length = 628 Score = 29.1 bits (62), Expect = 3.5 Identities = 21/60 (35%), Positives = 31/60 (51%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L +L+ L L +N+I ++LG + +L LDL N L L +L+ L LNNN Sbjct: 95 LKNLQYLELYSNNITGPVPSDLGNLTNLVSLDLYLNSFTGPIPDSLGKLFKLRFLRLNNN 154 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 P++ L L+ L L NNS+ +L ++ L+ LDLS N Sbjct: 137 PDSLGKLFKLRFLRLNNNSLTGPIPMSLTNIMTLQVLDLSNN 178 >At1g31420.1 68414.m03848 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profile: PF00069: Eukaryotic protein kinase domain Length = 592 Score = 29.1 bits (62), Expect = 3.5 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 1/79 (1%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILD-IPSANLGFVIHLEYLDLSENLIQQVSR 420 L H+++ P L L++L L NN++ IP+A LG LE + L N Sbjct: 81 LTYHKIMGPLPPDIGKLDHLRLLMLHNNALYGAIPTA-LGNCTALEEIHLQSNYFTGPIP 139 Query: 421 HGLPFLKELKHLDLNNNII 477 + L L+ LD+++N + Sbjct: 140 AEMGDLPGLQKLDMSSNTL 158 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/68 (25%), Positives = 34/68 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P ++L+ + L++N A +G + L+ LD+S N + L LK+L + Sbjct: 115 PTALGNCTALEEIHLQSNYFTGPIPAEMGDLPGLQKLDMSSNTLSGPIPASLGQLKKLSN 174 Query: 454 LDLNNNII 477 +++NN + Sbjct: 175 FNVSNNFL 182 >At3g16300.1 68416.m02057 integral membrane family protein contains TIGRFAM TIGR01569 : plant integral membrane protein TIGR01569; contains Pfam PF04535 : Domain of unknown function (DUF588); At2g38480, At1g45222 and others share this domain structure; distantly related to GP|14030504 salicylic acid-induced fragment 1 protein {Gossypium hirsutum} Length = 212 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +2 Query: 497 GFHSCLHYVIWDLSDNNMTLIPTSALSKLSNLSHLYLSG 613 GF LH +W LSD+ + L+ S+ + L +L L +SG Sbjct: 79 GFEFQLH-AVWSLSDSLIYLVVVSSATVLYSLIQLIISG 116 >At2g26730.1 68415.m03206 leucine-rich repeat transmembrane protein kinase, putative Length = 658 Score = 28.7 bits (61), Expect = 4.6 Identities = 24/79 (30%), Positives = 37/79 (46%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L+ L++LSLR+N + ++ + HL L L N L L LD+++N Sbjct: 90 LTELRVLSLRSNRLSGQIPSDFSNLTHLRSLYLQHNEFSGEFPTSFTQLNNLIRLDISSN 149 Query: 472 IIESVDSIRFS*LPSLRHL 528 SI FS + +L HL Sbjct: 150 --NFTGSIPFS-VNNLTHL 165 >At2g13800.1 68415.m01523 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 601 Score = 28.7 bits (61), Expect = 4.6 Identities = 22/60 (36%), Positives = 29/60 (48%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L +L+ L L NN+I LG ++ L LDL N I L L +L+ L L NN Sbjct: 93 LPNLQYLELFNNNITGEIPEELGDLMELVSLDLFANNISGPIPSSLGKLGKLRFLRLYNN 152 >At2g01950.1 68415.m00130 leucine-rich repeat transmembrane protein kinase, putative similar to brassinosteroid insensitive protein Length = 1143 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/66 (25%), Positives = 31/66 (46%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P+ + +L++L L +N + +G + +L D S+N +Q L L Sbjct: 628 PDEIGEMIALQVLELSHNQLSGEIPFTIGQLKNLGVFDASDNRLQGQIPESFSNLSFLVQ 687 Query: 454 LDLNNN 471 +DL+NN Sbjct: 688 IDLSNN 693 Score = 28.3 bits (60), Expect = 6.1 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +1 Query: 253 HRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 +RL P+ F LS L +L L NN+ LG L +LDL+ N Sbjct: 481 NRLTGEVPKDFGILSRLAVLQLGNNNFTGEIPPELGKCTTLVWLDLNTN 529 >At5g65700.1 68418.m08269 leucine-rich repeat transmembrane protein kinase, putative Length = 1003 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 373 LEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNI 474 L+ L L+ENLI + L L+HL+L+NN+ Sbjct: 95 LQNLSLAENLISGPIPPEISSLSGLRHLNLSNNV 128 >At5g63410.1 68418.m07960 leucine-rich repeat transmembrane protein kinase, putative contains similarity to receptor-like protein kinase Length = 680 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/66 (25%), Positives = 33/66 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P F+ LK+LS ++N + ++L + +EY+DL N + L +L Sbjct: 182 PSWFDSYWYLKVLSFKSNKLSGELHSSLLSLSTIEYIDLRANSLSGSLPDDLKCGSKLWF 241 Query: 454 LDLNNN 471 +D+++N Sbjct: 242 IDISDN 247 >At5g62710.1 68418.m07869 leucine-rich repeat family protein / protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 604 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 8 TQLTVLDISYNKILDLGSENFESNSEMRHLNLSNNF 115 T LT+LD+S N + + + +R LNLS NF Sbjct: 140 TFLTILDLSSNTLKGAIPSSISRLTRLRSLNLSTNF 175 >At5g06870.1 68418.m00777 polygalacturonase inhibiting protein 2 (PGIP2) identical to polygalacturonase inhibiting protein 2 (PGIP2) [Arabidopsis thaliana] gi|7800201|gb|AAF69828; contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611 Length = 330 Score = 28.3 bits (60), Expect = 6.1 Identities = 19/64 (29%), Positives = 32/64 (50%) Frame = +1 Query: 280 TFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLD 459 T L +L L L ++ L + +LEY+DLS N + L L++L++L+ Sbjct: 114 TIAKLKNLTFLRLSWTNLTGPVPEFLSQLKNLEYIDLSFNDLSGSIPSSLSSLRKLEYLE 173 Query: 460 LNNN 471 L+ N Sbjct: 174 LSRN 177 >At4g16950.2 68417.m02557 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein.; closest homolog in Col-0 to RPP5 of clutivar Landsberg erecta. Length = 1404 Score = 28.3 bits (60), Expect = 6.1 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +2 Query: 530 DLSDN-NMTLIPTSALSKLSNLSHLYLS 610 DLS++ N+T IP LSK +NL HLYL+ Sbjct: 922 DLSESENLTEIPD--LSKATNLKHLYLN 947 >At4g16950.1 68417.m02556 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein.; closest homolog in Col-0 to RPP5 of clutivar Landsberg erecta. Length = 1449 Score = 28.3 bits (60), Expect = 6.1 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +2 Query: 530 DLSDN-NMTLIPTSALSKLSNLSHLYLS 610 DLS++ N+T IP LSK +NL HLYL+ Sbjct: 922 DLSESENLTEIPD--LSKATNLKHLYLN 947 >At4g16920.1 68417.m02552 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1304 Score = 28.3 bits (60), Expect = 6.1 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +2 Query: 530 DLSDN-NMTLIPTSALSKLSNLSHLYLS 610 DLS++ N+T IP LSK +NL HLYL+ Sbjct: 916 DLSESENLTEIPD--LSKATNLKHLYLN 941 >At3g46350.1 68416.m05020 leucine-rich repeat protein kinase, putative contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 871 Score = 28.3 bits (60), Expect = 6.1 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = +1 Query: 310 LSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L L + + +A++ ++ LE LDLS+N + V L +K L ++L N Sbjct: 394 LKLSSKGLTGTIAADIQYLTSLEKLDLSDNKLVGVVPEFLANMKSLMFINLTKN 447 >At3g28890.1 68416.m03606 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 711 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 P++ L L +L+L NN+ +++G + LE LD+S+N Sbjct: 537 PKSIGLLKELLVLNLSNNAFTGHIPSSMGKLTALESLDVSQN 578 >At3g14350.3 68416.m01816 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich repeat transmembrane protein kinase 1 GB:AAC27894 from [Zea mays] Length = 689 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/58 (29%), Positives = 32/58 (55%) Frame = +1 Query: 298 SLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 +L+ L+L NN ++ + L+YL+L+ N ++Q++ L L LDL++N Sbjct: 118 NLERLNLANNQFTGSAQYSISMMAPLKYLNLAHNQLKQLA-IDFTKLTSLSILDLSSN 174 >At3g14350.2 68416.m01814 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich repeat transmembrane protein kinase 1 GB:AAC27894 from [Zea mays] Length = 680 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/58 (29%), Positives = 32/58 (55%) Frame = +1 Query: 298 SLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 +L+ L+L NN ++ + L+YL+L+ N ++Q++ L L LDL++N Sbjct: 81 NLERLNLANNQFTGSAQYSISMMAPLKYLNLAHNQLKQLA-IDFTKLTSLSILDLSSN 137 >At3g14350.1 68416.m01815 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich repeat transmembrane protein kinase 1 GB:AAC27894 from [Zea mays] Length = 717 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/58 (29%), Positives = 32/58 (55%) Frame = +1 Query: 298 SLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 +L+ L+L NN ++ + L+YL+L+ N ++Q++ L L LDL++N Sbjct: 118 NLERLNLANNQFTGSAQYSISMMAPLKYLNLAHNQLKQLA-IDFTKLTSLSILDLSSN 174 >At3g13380.1 68416.m01683 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1164 Score = 28.3 bits (60), Expect = 6.1 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +1 Query: 247 LKHRLVTFE-PETFEPLSSLKILSLRNNSIL-DIPSANLGFVIHLEYLDLSEN 399 L L+T E P L L IL L NNS+ +IPS LG +L +LDL+ N Sbjct: 506 LSSNLLTGEIPVGIGKLEKLAILQLGNNSLTGNIPS-ELGNCKNLIWLDLNSN 557 Score = 27.9 bits (59), Expect = 8.1 Identities = 20/77 (25%), Positives = 31/77 (40%) Frame = +2 Query: 23 LDISYNKILDLGSENFESNSEMRHLNLSNNFLKRLDKDAFVGXXXXXXXXXXXXEISNIH 202 LD+SYN + + + ++ LNL +N L D+F G ++ Sbjct: 644 LDLSYNAVSGSIPLGYGAMGYLQVLNLGHNLLTGTIPDSFGGLKAIGVLDLSHNDLQGFL 703 Query: 203 VQTFRDLSALERLDFSN 253 + LS L LD SN Sbjct: 704 PGSLGGLSFLSDLDVSN 720 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/66 (28%), Positives = 32/66 (48%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 P + + L++L+L +N + + G + + LDLS N +Q L L L Sbjct: 656 PLGYGAMGYLQVLNLGHNLLTGTIPDSFGGLKAIGVLDLSHNDLQGFLPGSLGGLSFLSD 715 Query: 454 LDLNNN 471 LD++NN Sbjct: 716 LDVSNN 721 >At2g41820.1 68415.m05168 leucine-rich repeat transmembrane protein kinase, putative Length = 890 Score = 28.3 bits (60), Expect = 6.1 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L SLK L L N+ + G + LE+LDLS N L+ L+ +++NN Sbjct: 85 LRSLKHLDLSGNNFNGRIPTSFGNLSELEFLDLSLNRFVGAIPVEFGKLRGLRAFNISNN 144 Query: 472 II 477 ++ Sbjct: 145 LL 146 >At1g72180.1 68414.m08346 leucine-rich repeat transmembrane protein kinase, putative similar to GI:3641252 from [Malus x domestica] (Plant Mol. Biol. 40 (6), 945-957 (1999)) Length = 977 Score = 28.3 bits (60), Expect = 6.1 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +1 Query: 298 SLKILSLRNNSILD-IPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNNI 474 +LK+L+L +N + IP NL + LE LD+S N + + + + +L L L NN Sbjct: 123 NLKVLNLTSNRLSGTIP--NLSPLKSLEILDISGNFLNGEFQSWIGNMNQLVSLGLGNNH 180 Query: 475 IE 480 E Sbjct: 181 YE 182 >At1g34420.1 68414.m04275 leucine-rich repeat family protein / protein kinase family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 966 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +2 Query: 5 YTQLTVLDISYNKILDLGSENFESNSEMRHLNLSNNFLKRL 127 Y +LT++D+S N++ + + S++ L LSNN+L L Sbjct: 226 YQELTLIDLSDNQLNGSIPSSLGNLSKLESLLLSNNYLSGL 266 >At1g29750.2 68414.m03638 leucine-rich repeat transmembrane protein kinase, putative / serine/threonine kinase, putative (RKF1) similar to receptor-like serine/threonine kinase GI:2465923 from [Arabidopsis thaliana]; identical to cDNA receptor-like serine/threonine kinase (RKF1) GI:2465922 Length = 1021 Score = 28.3 bits (60), Expect = 6.1 Identities = 23/75 (30%), Positives = 35/75 (46%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 LL +RL P+ F SSL L L +N+ LG ++HL+ L LS N + Sbjct: 153 LLVNRLSGEIPKEFGN-SSLTYLDLESNAFSGTIPQELGNLVHLKKLLLSSNKLTGTLPA 211 Query: 424 GLPFLKELKHLDLNN 468 L L+ + +N+ Sbjct: 212 SLARLQNMTDFRIND 226 >At1g29750.1 68414.m03637 leucine-rich repeat transmembrane protein kinase, putative / serine/threonine kinase, putative (RKF1) similar to receptor-like serine/threonine kinase GI:2465923 from [Arabidopsis thaliana]; identical to cDNA receptor-like serine/threonine kinase (RKF1) GI:2465922 Length = 1006 Score = 28.3 bits (60), Expect = 6.1 Identities = 23/75 (30%), Positives = 35/75 (46%) Frame = +1 Query: 244 LLKHRLVTFEPETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRH 423 LL +RL P+ F SSL L L +N+ LG ++HL+ L LS N + Sbjct: 138 LLVNRLSGEIPKEFGN-SSLTYLDLESNAFSGTIPQELGNLVHLKKLLLSSNKLTGTLPA 196 Query: 424 GLPFLKELKHLDLNN 468 L L+ + +N+ Sbjct: 197 SLARLQNMTDFRIND 211 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +1 Query: 382 LDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 LD+ ++ Q V+R+G FL+EL ++NN+ Sbjct: 182 LDIIKHTAQFVARNGQSFLRELMRREVNNS 211 >At5g58300.1 68418.m07298 leucine-rich repeat transmembrane protein kinase, putative Length = 654 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/42 (45%), Positives = 23/42 (54%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 P TF+ L L LSL+NN L P NL + L L+LS N Sbjct: 175 PATFQNLKQLTGLSLQNNK-LSGPVPNLD-TVSLRRLNLSNN 214 >At5g49760.1 68418.m06163 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 953 Score = 27.9 bits (59), Expect = 8.1 Identities = 25/93 (26%), Positives = 39/93 (41%), Gaps = 8/93 (8%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQ-------QVSRHGLP 432 PE+ L L LSL N ++G + L + D+++N I+ S GL Sbjct: 131 PESIGTLKELIYLSLNLNKFSGTIPPSIGLLSKLYWFDIADNQIEGELPVSNGTSAPGLD 190 Query: 433 FLKELKHLDLNNNIIE-SVDSIRFS*LPSLRHL 528 L + KH N + ++ FS SL H+ Sbjct: 191 MLLQTKHFHFGKNKLSGNIPKELFSSNMSLIHV 223 >At5g25930.1 68418.m03081 leucine-rich repeat family protein / protein kinase family protein contains similarity to Swiss-Prot:P47735 receptor-like protein kinase 5 precursor [Arabidopsis thaliana]; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1005 Score = 27.9 bits (59), Expect = 8.1 Identities = 24/67 (35%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLK-ELK 450 P T LS+L L L N L L+YLDLS+NL+ + L EL Sbjct: 80 PTTICDLSNLNFLDLSFNYFAGEFPTVLYNCTKLQYLDLSQNLLNGSLPVDIDRLSPELD 139 Query: 451 HLDLNNN 471 +LDL N Sbjct: 140 YLDLAAN 146 >At4g29450.1 68417.m04204 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 863 Score = 27.9 bits (59), Expect = 8.1 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +1 Query: 373 LEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 LE LDLS N +QQ L LK LK L+L N Sbjct: 439 LESLDLSNNDLQQNVPEFLADLKHLKVLNLKGN 471 >At4g13880.1 68417.m02150 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 725 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/69 (27%), Positives = 35/69 (50%) Frame = +1 Query: 274 PETFEPLSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKH 453 PE+ L L +L++ NN+ +L + +L+ LDLS+N + L L L+ Sbjct: 572 PESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPPELGKLTFLEW 631 Query: 454 LDLNNNIIE 480 ++ + N +E Sbjct: 632 MNFSYNRLE 640 >At3g53240.1 68416.m05868 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.1 [Lycopersicon pimpinellifolium] gi|1184075|gb|AAC15779 Length = 891 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVIHLEYLDLSEN 399 L+SL+ L+L NN L +++ + ++E++DLS N Sbjct: 372 LASLRHLNLSNNEFLGNMPSSMARMENIEFMDLSYN 407 >At3g46330.1 68416.m05017 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 878 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = +1 Query: 310 LSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L+L ++ + +N + HLE LDLS N + + L +K L ++L+ N Sbjct: 417 LNLSSSGLSGTIVSNFQNLAHLESLDLSNNSLSGIVPEFLATMKSLLVINLSGN 470 >At3g13065.1 68416.m01632 leucine-rich repeat transmembrane protein kinase, putative leucine-rich repeat transmembrane protein kinase 1 GB:AAC27894 from [Zea mays] Length = 646 Score = 27.9 bits (59), Expect = 8.1 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 2/78 (2%) Frame = +1 Query: 292 LSSLKILSLRNNSILDIPSANLGFVI--HLEYLDLSENLIQQVSRHGLPFLKELKHLDLN 465 L SL L + N++ + NL + + L YLD SEN + + + +L +L+L Sbjct: 53 LKSLTYLDVSKNNL----NGNLPYQLPDKLTYLDGSENDFNGNVPYSVSLMNDLSYLNLG 108 Query: 466 NNIIESVDSIRFS*LPSL 519 N + S F LP L Sbjct: 109 RNNLNGELSDMFQKLPKL 126 >At2g14440.1 68415.m01616 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 886 Score = 27.9 bits (59), Expect = 8.1 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +1 Query: 310 LSLRNNSILDIPSANLGFVIHLEYLDLSENLIQQVSRHGLPFLKELKHLDLNNN 471 L L ++ + + + ++ + L LDLS N + V L L L+ LDL+NN Sbjct: 417 LDLSSSGLTGVITPSIQNLTMLRELDLSNNNLTGVIPPSLQNLTMLRELDLSNN 470 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,000,491 Number of Sequences: 28952 Number of extensions: 280636 Number of successful extensions: 2128 Number of sequences better than 10.0: 239 Number of HSP's better than 10.0 without gapping: 1078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2081 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1775300800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -