BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0759 (557 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF022985-15|AAB69969.2| 435|Caenorhabditis elegans Hypothetical... 28 5.2 AL117206-7|CAE18041.2| 170|Caenorhabditis elegans Hypothetical ... 27 9.1 >AF022985-15|AAB69969.2| 435|Caenorhabditis elegans Hypothetical protein T15B7.16 protein. Length = 435 Score = 27.9 bits (59), Expect = 5.2 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +2 Query: 380 KKGPSIDIVISFD*LILMRSKFFFLLFYLHSMAFVCYKDVKFNL 511 K P + V S D +++ + F FL +AFVCY D + NL Sbjct: 310 KNLPRVGYVKSIDVYMVLTTAFIFLTMI--EVAFVCYLDSENNL 351 >AL117206-7|CAE18041.2| 170|Caenorhabditis elegans Hypothetical protein Y67A10A.10 protein. Length = 170 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +1 Query: 1 KKYIEVNLNPNLTLHIRESA 60 K+YIE+ NPNLT+ +++ A Sbjct: 61 KEYIELEGNPNLTMDMKQKA 80 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,768,768 Number of Sequences: 27780 Number of extensions: 161502 Number of successful extensions: 377 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 377 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1144922904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -