Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e96h0759
         (557 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g34660.1 68415.m04258 glutathione S-conjugate ABC transporter...    27   8.5  

>At2g34660.1 68415.m04258 glutathione S-conjugate ABC transporter
           (MRP2) almost identical to MgATP-energized glutathione
           S-conjugate pump GI:2909781 from [Arabidopsis thaliana]
          Length = 1623

 Score = 27.1 bits (57), Expect = 8.5
 Identities = 13/39 (33%), Positives = 25/39 (64%), Gaps = 2/39 (5%)
 Frame = +3

Query: 3   KIYRSQLK--SKFNVTHSRIGELLILNNVDIITVYYNMY 113
           KIY  +L+   +F V ++ +G++++LN V  +  YY+ Y
Sbjct: 133 KIYIRELRWYVRFAVIYALVGDMVLLNLVLSVKEYYSSY 171


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,758,983
Number of Sequences: 28952
Number of extensions: 132851
Number of successful extensions: 275
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 274
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 275
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1062855648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)