BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0752 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 26 0.40 DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 23 3.7 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 6.4 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 25.8 bits (54), Expect = 0.40 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +1 Query: 454 DQRCFICAGWCHEASKMGYIRMLLDVDDGDDEIRLVHKLTE 576 D + F+ WC+E + I M + D G RLVH + E Sbjct: 213 DDKTFLV--WCNEEDHLRIISMQMGGDLGQVYRRLVHAVNE 251 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 22.6 bits (46), Expect = 3.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 114 PLRSKMKCYFGCL 152 P K+KCYF C+ Sbjct: 63 PEDEKLKCYFNCV 75 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.8 bits (44), Expect = 6.4 Identities = 7/26 (26%), Positives = 14/26 (53%) Frame = +2 Query: 458 KDALFVQDGVMKRAKWDILECCWMWM 535 ++ + V D ++ A W + WMW+ Sbjct: 392 EEGMKVFDELLLDADWSVNAGMWMWL 417 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,248 Number of Sequences: 438 Number of extensions: 3845 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -